Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells, K-562 cells, U-937 cells |
| Positive IHC detected in | human tonsillitis tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60196-1-Ig targets Fas/CD95 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, zebrafish |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3718 Product name: Recombinant human FAS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 156-335 aa of BC012479 Sequence: ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV Predict reactive species |
| Full Name | Fas (TNF receptor superfamily, member 6) |
| Calculated Molecular Weight | 35-38 kDa |
| Observed Molecular Weight | 38-45 kDa |
| GenBank Accession Number | BC012479 |
| Gene Symbol | Fas/CD95 |
| Gene ID (NCBI) | 355 |
| RRID | AB_10892669 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P25445 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAS, also named as CD95, APO-1, APT1, FAS1 and TNFRSF6, is a receptor for TNFSF6/FASLG. It is a cell surface receptor belonging to the TNF receptor superfamily, can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). This anti-Fas monoclonal antibody can be used to induce apoptosis in cell cultures through Fas by imitating the Fas-ligand.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Fas/CD95 antibody 60196-1-Ig | Download protocol |
| WB protocol for Fas/CD95 antibody 60196-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Fas/CD95 Monoclonal antibody (1G7F7), catalog number 60196-1-Ig, has 16 citations across journals including Cell, Molecular Metabolism, Food & Function, Molecular Neurobiology, Biochimica et Biophysica Acta, iScience, Chemosphere, Heliyon, Journal of Cellular Physiology, Journal of Pharmaceutical and Biomedical Analysis, Frontiers in Genetics, PLoS ONE, Journal of Stomatology Oral and Maxillofacial Surgery, Oncology Targets & Therapy, and Toxicology Industrial Health. Research fields span oncology, apoptosis, metabolism, neuroscience, immunology, cardiology, toxicology, and senescence.
| Species | Application | Title |
|---|---|---|
Cell Neutrophil elastase selectively kills cancer cells and attenuates tumorigenesis.
| ||
Mol Metab Let-7 suppresses liver fibrosis by inhibiting hepatocyte apoptosis and TGF-β production | ||
Food Funct Hawk tea prevents high-fat diet-induced obesity in mice by activating the AMPK/ACC/SREBP1c signaling pathways and regulating the gut microbiota. | ||
Mol Neurobiol Ox-LDL Induces Neuron Apoptosis and Worsens Neurological Outcomes in aSAH via Fas/FADD Pathway | ||
J Physiol Biochem miR-128-3p regulates 3T3-L1 adipogenesis and lipolysis by targeting Pparg and Sertad2. | ||
Biochim Biophys Acta Down-regulation of islet amyloid polypeptide expression induces death of human annulus fibrosus cells via mitochondrial and death receptor pathways. |
