Fas/CD95 Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 60196-1-Ig (same clone as 60196-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 60196-1-Ig (FAS/CD95 antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60196-1-Ig (same clone as 60196-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60196-1-Ig (FAS/CD95 antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 60196-1-Ig (same clone as 60196-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 60196-1-Ig (FAS/CD95 antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 60196-1-Ig (same clone as 60196-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 60196-1-Ig (FAS/CD95 antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 60196-1-Ig (same clone as 60196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60196-1-Ig (FAS/CD95 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 60196-1-Ig (same clone as 60196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60196-1-Ig (FAS/CD95 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60196-1-Ig (same clone as 60196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60196-1-Ig (FAS/CD95 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60196-1-Ig (same clone as 60196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60196-1-Ig (FAS/CD95 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60196-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Fas/CD95 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60196-1-PBS

Clone No.1G7F7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

FAS, 1G7F7, ALPS1A, APO-1, Apo-1 antigen

---

Product Information

60196-1-PBS targets Fas/CD95 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3718

  Product name: Recombinant human FAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 156-335 aa of BC012479

  Sequence: ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

• Full Name: Fas (TNF receptor superfamily, member 6)
• Calculated Molecular Weight: 35-38 kDa
• Observed Molecular Weight: 38-45 kDa
• GenBank Accession Number: BC012479
• Gene Symbol: Fas/CD95
• Gene ID (NCBI): 355
• RRID: AB_10892669
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P25445
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAS, also named as CD95, APO-1, APT1, FAS1 and TNFRSF6, is a receptor for TNFSF6/FASLG. It is a cell surface receptor belonging to the TNF receptor superfamily, can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). This anti-Fas monoclonal antibody can be used to induce apoptosis in cell cultures through Fas by imitating the Fas-ligand.