Fas Ligand Polyclonal antibody

Fas Ligand Polyclonal Antibody for ELISA
Cat No. 11322-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Apoptosis antigen ligand, APT1LG1, APTL, CD178, CD95 L, CD95 ligand, CD95L, Fas antigen ligand, Fas ligand, FASL, FASLG, TNFSF6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Published Applications

WBSee 2 publications below

Product Information

11322-1-AP targets Fas Ligand in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1816

Product name: Recombinant human FASL,FASLG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-281 aa of BC017502

Sequence: MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Predict reactive species
Full Name Fas ligand (TNF superfamily, member 6)
Calculated Molecular Weight 281 aa, 31 kDa
GenBank Accession NumberBC017502
Gene Symbol Fas Ligand
Gene ID (NCBI) 356
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP48023
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Publications

SpeciesApplicationTitle
humanWB

J Biochem Mol Toxicol

Identification of apoptosis-associated protein factors distinctly expressed in cigarette smoke condensate-exposed airway bronchial epithelial cells.

Authors - Ben-Cheng Lin
pigWB

Comp Biochem Physiol C Toxicol Pharmacol

Effects of Hericium erinaceus polysaccharide in porcine IPEC-J2 intestinal epithelial cells against apoptosis induced by oxidative stress

Authors - Jian Li
Loading...
||
New chat Able
正在加载,请稍候...