Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, SH-SY5Y cells, mouse liver tissue, rat liver tissue |
Positive IP detected in | mouse liver tissue |
Positive IHC detected in | human breast cancer tissue, mouse brain tissue, mouse brown adipose tissue, rat brown adipose tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 5 publications below |
WB | See 252 publications below |
IHC | See 36 publications below |
IF | See 14 publications below |
IP | See 5 publications below |
CoIP | See 1 publications below |
Product Information
10624-2-AP targets FASN in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, bovine, sheep, goat, duck |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0975 Product name: Recombinant human FASN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 142-439 aa of BC007909 Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG Predict reactive species |
Full Name | fatty acid synthase |
Calculated Molecular Weight | 272 kDa |
Observed Molecular Weight | 250-272 kDa |
GenBank Accession Number | BC007909 |
Gene Symbol | FASN |
Gene ID (NCBI) | 2194 |
RRID | AB_2100801 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P49327 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FASN antibody 10624-2-AP | Download protocol |
IHC protocol for FASN antibody 10624-2-AP | Download protocol |
IF protocol for FASN antibody 10624-2-AP | Download protocol |
IP protocol for FASN antibody 10624-2-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab High dietary fructose promotes hepatocellular carcinoma progression by enhancing O-GlcNAcylation via microbiota-derived acetate | ||
Nat Cancer Integrative proteogenomic profiling of high-risk prostate cancer samples from Chinese patients indicates metabolic vulnerabilities and diagnostic biomarkers | ||
Cell Metab Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism. | ||
Cell Metab TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis. | ||
Nat Commun Senescence-associated 13-HODE production promotes age-related liver steatosis by directly inhibiting catalase activity | ||
Nat Commun A nanoemulsion targeting adipose hypertrophy and hyperplasia shows anti-obesity efficiency in female mice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH YINGJIAN (Verified Customer) (08-07-2025) | Clear signal and very low background—saved a lot of optimization time
![]() |
FH K (Verified Customer) (12-20-2020) | I got good results with this Ab for WB at (1:1000) and IHC (1:200)
|
FH Iram (Verified Customer) (09-18-2020) | FASN antibody gives a very clean bands.Excellent antibody
|