• Featured Product
  • KD/KO Validated

FASN Polyclonal antibody

FASN Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10624-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

FAS, fatty acid synthase, Type I fatty acid synthase

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, SH-SY5Y cells, mouse liver tissue, rat liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman breast cancer tissue, mouse brain tissue, mouse brown adipose tissue, rat brown adipose tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10624-2-AP targets FASN in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, zebrafish, bovine, sheep, goat, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0975

Product name: Recombinant human FASN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 142-439 aa of BC007909

Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

Predict reactive species
Full Name fatty acid synthase
Calculated Molecular Weight 272 kDa
Observed Molecular Weight 250-272 kDa
GenBank Accession NumberBC007909
Gene Symbol FASN
Gene ID (NCBI) 2194
RRIDAB_2100801
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49327
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.

Protocols

Product Specific Protocols
WB protocol for FASN antibody 10624-2-APDownload protocol
IHC protocol for FASN antibody 10624-2-APDownload protocol
IF protocol for FASN antibody 10624-2-APDownload protocol
IP protocol for FASN antibody 10624-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Metab

High dietary fructose promotes hepatocellular carcinoma progression by enhancing O-GlcNAcylation via microbiota-derived acetate

Authors - Peng Zhou
humanIHC

Nat Cancer

Integrative proteogenomic profiling of high-risk prostate cancer samples from Chinese patients indicates metabolic vulnerabilities and diagnostic biomarkers

Authors - Baijun Dong
mouseWB

Cell Metab

Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism.

Authors - Yi Fu
mouseWB

Cell Metab

TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis.

Authors - Dong Huang
mouseWB

Nat Commun

Senescence-associated 13-HODE production promotes age-related liver steatosis by directly inhibiting catalase activity

Authors - Jinjie Duan
mouseIF

Nat Commun

A nanoemulsion targeting adipose hypertrophy and hyperplasia shows anti-obesity efficiency in female mice

Authors - Yichao Lu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

YINGJIAN (Verified Customer) (08-07-2025)

Clear signal and very low background—saved a lot of optimization time

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: liver
FASN Antibody Western Blot validation (1:5000 dilution) in liver (Cat no:10624-2-AP)
FH

K (Verified Customer) (12-20-2020)

I got good results with this Ab for WB at (1:1000) and IHC (1:200)

  • Applications: Western Blot, Immunohistochemistry
  • Cell Tissue Type: mouse liver tissues and rat liver
FH

Iram (Verified Customer) (09-18-2020)

FASN antibody gives a very clean bands.Excellent antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000 for western
  • Cell Tissue Type: Human colon cancer
Loading...