FASN Polyclonal antibody, PBS Only

• 

  WB analysis using 10624-2-AP (same clone as 10624-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10624-2-AP (FASN antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 10624-2-AP (same clone as 10624-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10624-2-AP (FASN antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10624-2-AP (same clone as 10624-2-PBS)

  WB result of FASN antibody (10624-2-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FASN transfected HeLa cells. This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 10624-2-AP (same clone as 10624-2-PBS)

  IP result of anti-FASN (IP:10624-2-AP, 4ug; Detection:10624-2-AP 1:10000) with mouse liver tissue lysate 2400 ug. This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10624-2-AP (same clone as 10624-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10624-2-AP (FASN antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brown adipose using 10624-2-AP (same clone as 10624-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 10624-2-AP (FASN antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brown adipose using 10624-2-AP (same clone as 10624-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brown adipose tissue slide using 10624-2-AP (FASN antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10624-2-AP (same clone as 10624-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10624-2-AP (FASN antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10624-2-AP (same clone as 10624-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using FASN antibody (10624-2-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 10624-2-AP (same clone as 10624-2-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human FASN (10624-2-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 10624-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FASN Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10624-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

FAS, fatty acid synthase, Type I fatty acid synthase

---

Product Information

10624-2-PBS targets FASN in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0975

  Product name: Recombinant human FASN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-439 aa of BC007909

  Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

• Full Name: fatty acid synthase
• Calculated Molecular Weight: 272 kDa
• Observed Molecular Weight: 250-272 kDa
• GenBank Accession Number: BC007909
• Gene Symbol: FASN
• Gene ID (NCBI): 2194
• RRID: AB_2100801
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49327
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.