FC tag Polyclonal antibody

• 

  WB analysis using 28108-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28108-1-AP (FC tag antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

FC tag Polyclonal Antibody for WB, ELISA

Cat No. 28108-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

FC tag, mFC tag

---

Tested Applications

• Positive WB detected in: Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28108-1-AP targets FC tag in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27844

  Product name: Recombinant mouse FC tag protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-232 aa of

  Sequence: PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

• Full Name: FC tag
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 55 kDa
• RRID: AB_3086029
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This antibody detects the Fc fragment of mouse IgG2a.