FER Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FER Polyclonal antibody (25287-1-AP)

FER Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 25287-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA
For FC, select conjugated version.

Synonyms

EC:2.7.10.2, Feline encephalitis virus-related kinase FER, Fujinami poultry sarcoma/Feline sarcoma-related protein Fer, p94 Fer, p94-Fer

• 

  WB analysis of NIH/3T3 using 25287-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 25287-1-AP (FER Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 25287-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 25287-1-AP (FER Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 25287-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25287-1-AP (FER Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 25287-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25287-1-AP (FER Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 25287-1-AP

  IP result of anti-FER (IP:25287-1-AP, 4ug; Detection:25287-1-AP 1:1000) with MCF-7 cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 25287-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25287-1-AP (FER Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 25287-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25287-1-AP (FER Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 25287-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25287-1-AP (FER antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 25287-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25287-1-AP (FER antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 25287-1-AP

  Immunofluorescent analysis of MCF-7 cells using 25287-1-AP (FER antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 25287-1-AP

  Immunofluorescent analysis of MCF-7 cells using 25287-1-AP (FER antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FER in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, A431 cells, HeLa cells, MCF-7 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human kidney tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25287-1-AP targets FER in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18173

  Product name: Recombinant human FER protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-445 aa of BC017060

  Sequence: PLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALS

• Full Name: fer (fps/fes related) tyrosine kinase
• Calculated Molecular Weight: 822 aa, 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC017060
• Gene Symbol: FER
• Gene ID (NCBI): 2241
• RRID: AB_2880009
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16591
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FER(Tyrosine-protein kinase Fer) is also named as TYK3 and belongs to the protein kinase superfamily. Tyrosine-protein kinase acts downstream of cell surface receptors for growth factors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, lamellipodia formation, cell adhesion, cell migration and chemotaxis. This protein has 3 isoforms produced by alternative promoter usage and alternative splicing.

Publications

What published studies show

The FER Polyclonal antibody (Cat# 25287-1-AP) has 5 total citations published in Nature Communications (×2), Cell Reports, Journal of Biological Chemistry, and BMC Cancer. The associated research fields include central nervous system tumor biology, actin cytoskeletal dynamics and cell migration, hematopoietic stem cell differentiation, ovarian cancer cell motility/invasiveness via PROTAC targeting, and circular RNA-mediated cell proliferation regulation.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP,IF	Nat Commun; Spatiotemporal H2O2 flashes coordinate actin cytoskeletal remodeling and regulate cell migration and wound healing; Authors - Maurice O'Mara
	WB	Nat Commun; Molecular landscape, subtypes, and therapeutic vulnerabilities of central nervous system solitary fibrous tumors; Authors - Chenhui Zhao
		Cell Rep; Bcl11a orchestrates multilineage integrity in aging hematopoiesis by regulating multipotent progenitor fate decisions; Authors - Linlin Zhang
human	WB	J Biol Chem; Development of the non-receptor tyrosine kinase FER-targeting PROTACs as a potential strategy for antagonizing ovarian cancer cell motility and invasiveness; Authors - Yanchun Zhang
human	WB	BMC Cancer; The circular RNA CDR1as regulate cell proliferation via TMED2 and TMED10.; Authors - Xue Yang