CoraLite® Plus 488-conjugated FER Polyclonal antibody

• 

  FC experiment of Jurkat using CL488-25287

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human FER (CL488-25287) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

FER Polyclonal Antibody for FC (Intra)

Cat No. CL488-25287

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

Synonyms

Proto-oncogene c-Fer, p94-Fer, p94 Fer, Fujinami poultry sarcoma/Feline sarcoma-related protein Fer, Feline encephalitis virus-related kinase FER

---

Tested Applications

• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25287 targets FER in FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18173

  Product name: Recombinant human FER protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-445 aa of BC017060

  Sequence: PLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALS

• Full Name: fer (fps/fes related) tyrosine kinase
• Calculated Molecular Weight: 822 aa, 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC017060
• Gene Symbol: FER
• Gene ID (NCBI): 2241
• RRID: AB_2919202
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16591
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FER(Tyrosine-protein kinase Fer) is also named as TYK3 and belongs to the protein kinase superfamily. Tyrosine-protein kinase acts downstream of cell surface receptors for growth factors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, lamellipodia formation, cell adhesion, cell migration and chemotaxis. This protein has 3 isoforms produced by alternative promoter usage and alternative splicing.