Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, mouse brain tissue, mouse heart tissue, pig brain tissue, rat brain tissue, rat heart tissue, HepG2 cells, Jurkat cells, PC-12 cells, mouse spleen tissue, rat spleen tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | rat brain tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, Hepa1-6 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:14000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10956-1-AP targets FIS1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, zebrafish, hamster, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1409 Product name: Recombinant human FIS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC009428 Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Predict reactive species |
| Full Name | fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC009428 |
| Gene Symbol | FIS1 |
| Gene ID (NCBI) | 51024 |
| RRID | AB_2102532 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y3D6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. This antibody was raised against the full-length of human Fis1 protein, and recognizes endogenous Fis1 protein in various lysates. (PMID: 21257639, 21459773, 23333625)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FIS1 antibody 10956-1-AP | Download protocol |
| IHC protocol for FIS1 antibody 10956-1-AP | Download protocol |
| IP protocol for FIS1 antibody 10956-1-AP | Download protocol |
| WB protocol for FIS1 antibody 10956-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
DRP1 Antibody (Cat# 10956-1-AP) has 531 total citations spanning journals including Nature, Cell, Cell Metabolism, Nature Communications, Autophagy, Redox Biology, Free Radical Biology and Medicine, Cell Death & Disease, Theranostics, and many others. Research fields encompass mitochondrial dynamics (fission/fusion), mitophagy, neurodegeneration, cardiovascular disease, cancer, diabetes, renal injury, oxidative stress, inflammation, stem cell biology, bone/joint disorders, and environmental toxicology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Protein C receptor maintains cancer stem cell properties via activating lipid synthesis in nasopharyngeal carcinoma. | ||
Nature Distinct fission signatures predict mitochondrial degradation or biogenesis.
| ||
Cell MTFP1 controls mitochondrial fusion to regulate inner membrane quality control and maintain mtDNA levels
| ||
Cell Metab Mitochondrial Dynamics Is Critical for the Full Pluripotency and Embryonic Developmental Potential of Pluripotent Stem Cells. | ||
Cell Metab Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation |
Reviews
What customers say
All four reviewers rate this antibody highly (average 4.75/5). Users report reliable performance primarily in Western Blot across diverse samples including mouse heart tissue, HEK293/HeLa cells, primary rat cortical neurons, RPE cells, and H69/HUCCT-1 cell lines. Recommended dilutions range from 1:100 to 1:2,000 depending on the application and target expression level. One user also confirmed successful use in immunofluorescence. Overall, customers describe the antibody as excellent and consistent for detecting both endogenous and overexpressed Fis1.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Megan (Verified Customer) (06-22-2021) | RPE cell over-expressing pcDNA hFis1. Note 1:500 was used here to detect over-expressed Fis1, but we also use 1:100 when detecting endogenous Fis1. Also successfully used to detect endogenous Fis1 levels via Western Blot (used @ 1:1000).
 |
Siting (Verified Customer) (01-28-2020) | This antibody worked perfectly for western blot.
|
Chun (Verified Customer) (07-03-2019) | This antibody is excellent/
|
Kishor (Verified Customer) (12-13-2018) | I got good results in both rat liver protein and H69 cells.
 |
