• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated FIS1 Polyclonal antibody

FIS1 Polyclonal Antibody for IF/ICC
Cat No. CL488-10956

Host / Isotype

Rabbit / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

CGI 135, FIS1, FIS1 homolog, hFis1, TPR repeat protein 11, TTC11

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10956 targets FIS1 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG1
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1409

Product name: Recombinant human FIS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-152 aa of BC009428

Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Predict reactive species
Full Name fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC009428
Gene Symbol FIS1
Gene ID (NCBI) 51024
RRIDAB_2923730
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y3D6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. This antibody was raised against the full-length of human Fis1 protein, and recognizes endogenous Fis1 protein in various lysates. (PMID: 21257639, 21459773, 23333625)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FIS1 antibody CL488-10956Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...