• Featured Product
  • KD/KO Validated

Fibronectin Polyclonal antibody

Fibronectin Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA
Cat No. 15613-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IF/ICC, FC (Intra), IP, ELISA

FN1, Anastellin, CIG, Cold insoluble globulin, Cold-insoluble globulin

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma, NIH/3T3 cells, MDA-MB-453s cells
Positive IP detected inNIH/3T3 cells
Positive IHC detected inhuman normal colon
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:20000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15613-1-AP targets Fibronectin in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, bovine, hamster, sheep, medaka embryos
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8004

Product name: Recombinant human FN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2177-2386 aa of BC005858

Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE

Predict reactive species
Full Name fibronectin 1
Calculated Molecular Weight 2386 aa, 263 kDa
Observed Molecular Weight 250-275 kDa
GenBank Accession NumberBC005858
Gene Symbol Fibronectin
Gene ID (NCBI) 2335
RRIDAB_2105691
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02751
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibronectins play a role in cell adhesion, motility, wound healing, and the maintenance of cell shape. Fibronectins bind to cell surfaces via interactions with integrins and various molecules such as collagen, fibrin, heparin, DNA, and actin (PMID: 3326130). Cellular interaction with fibronectin (FN1) promotes cell cycle progression and proliferation by influencing cyclins. 

What is the molecular weight of FN1?

The molecular weight of FN1 is 220 kDa. 

What is the tissue specificity of FN1?

FN1 is a large glycoprotein that exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1) (PMID: 21923916). Plasma FN1, or the dimeric form, is secreted by hepatocytes, whereas cellular FN1, the dimeric or cross-linked multimeric form, is produced by fibroblasts and epithelial cells and deposited as fibrils in the extracellular matrix. 

What are the post-translational modifications of FN1?

FN1 is often sulfated and its C-terminal NC1 peptide, anastellin, is produced as a result of proteolytic processing and can inhibit tumor growth, angiogenesis, and metastasis by activating p38 MAPK and inhibiting lysophospholipid signaling (PMID: 11209058).

What is FN1's role in embryogenesis?

Fibronectin has a crucial role in the development of the left-right body axis during embryogenesis (PMID: 21466802). 

What is FN1's involvement in disease?

Fibronectin glomerulopathy is a kidney disease that eventually leads to end-stage renal disease and is caused by mutations in the FN1 gene. Mutations in FN1 lead to the production of abnormal fibronectin protein that is deposited in the glomeruli of the kidney (PMID: 18268355).


Protocols

Product Specific Protocols
WB protocol for Fibronectin antibody 15613-1-APDownload protocol
IHC protocol for Fibronectin antibody 15613-1-APDownload protocol
IF protocol for Fibronectin antibody 15613-1-APDownload protocol
IP protocol for Fibronectin antibody 15613-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat

Adv Mater

Neonatal Tissue-derived Extracellular Vesicle Therapy (NEXT): A Potent Strategy for Precision Regenerative Medicine

Authors - Peng Lou
mouse

Cell Metab

The phytochemical hyperforin triggers thermogenesis in adipose tissue via a Dlat-AMPK signaling axis to curb obesity.

Authors - Suzhen Chen
mouseIF

J Clin Invest

Mitochondrial dysfunction in macrophages promotes inflammation and suppresses repair after myocardial infarction

Authors - Shanshan Cai
humanWB

Nat Protoc

Responsive and activable nanomedicines for remodeling the tumor microenvironment.

Authors - Yinlong Zhang
human

Nat Commun

Schwann cells regulate tumor cells and cancer-associated fibroblasts in the pancreatic ductal adenocarcinoma microenvironment

Authors - Meilin Xue
humanWB

Acta Pharm Sin B

KCTD4 interacts with CLIC1 to disrupt calcium homeostasis and promote metastasis in esophageal cancer

Authors - Cancan Zheng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Zach (Verified Customer) (08-29-2025)

This antibody works great with chronic pancreatitis samples.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: pancreas
FH

Ilaria (Verified Customer) (08-11-2025)

The fibronectin antibody performed very well, providing a strong and clear signal even at a higher dilution of 1:500. It was tested on mouse brain samples that were snap-frozen after collection using dry ice and 2-methylbutane, then post-fixed with acetone and ethanol. Blood vessel structures were clearly visualised, and the antibody also allowed for the assessment of BBB leakage.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
FH

Angie (Verified Customer) (07-26-2025)

WB showed a single band above 250 kDa at dilution of 1:500 incubated overnight at 4 °C. Secondary antibody: Donkey-anti-rabbit (Alexa Fluor 680) at 1:20000 dilution incubated at room temperature for 1 hour.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: A549
Fibronectin Antibody Western Blot validation (1:500 dilution) in A549 (Cat no:15613-1-AP)
FH

Christelle (Verified Customer) (12-19-2024)

Immunofluorescence analysis of (PFA 4%) fixed and (BSA 1%, Saponin 0.1%) permeabilized HRMC cells using the Fibronectin antibody #15613-1-AP at dilution 1:100 and goat anti-rabbit antibody AF488 labelled, Abberior STAR Red membrane probe (yellow), Dapi (nucleus, blue). Find attached 2 files : - merged channels: dapi, green - merged channels: dapi, green, yellow

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human renal mesangial cells (HMRC)
Fibronectin Antibody Immunofluorescence validation (1:100 dilution) in Human renal mesangial cells (HMRC) (Cat no:15613-1-AP)
FH

Ruchi (Verified Customer) (06-02-2023)

The Ab was tried on mouse skin on diabetic wounds.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Mouse skin
Fibronectin Antibody Immunofluorescence validation (1:50 dilution) in Mouse skin (Cat no:15613-1-AP)
FH

PK (Verified Customer) (03-20-2023)

excellent

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: fibroblast
Fibronectin Antibody Western Blot validation (1000 dilution) in fibroblast (Cat no:15613-1-AP)
FH

Susanne (Verified Customer) (08-23-2022)

under reduced conditions, blocked with 5% milk powder, incubation over night 4°C

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 : 1000
  • Cell Tissue Type: supernatant from human primary fibroblasts (serumfree !)
Fibronectin Antibody Western Blot validation (1 : 1000 dilution) in supernatant from human primary fibroblasts (serumfree !) (Cat no:15613-1-AP)
FH

Pankhuri (Verified Customer) (08-19-2022)

I tried this antibody for IF in neural stem cells. It works great in the conc. 1:200.

  • Applications: Immunofluorescence
  • Cell Tissue Type: Progenitor cells
Fibronectin Antibody Immunofluorescence validation ( dilution) in Progenitor cells (Cat no:15613-1-AP)
FH

Ren Jie (Verified Customer) (07-11-2022)

Very clean bands near 220 kD indicating fibronectin monomer

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human immortalized mammary fibroblasts
Fibronectin Antibody Western Blot validation (1:1000 dilution) in Human immortalized mammary fibroblasts (Cat no:15613-1-AP)
FH

SD (Verified Customer) (07-08-2022)

Good

  • Applications: Western Blot
  • Cell Tissue Type: Fibroblast
Fibronectin Antibody Western Blot validation ( dilution) in Fibroblast (Cat no:15613-1-AP)
FH

zunyi (Verified Customer) (03-11-2022)

This ab is used for immunohistochemistry on mouse paraffin-embedded sections. Antigen-retrieve, using pH 6.0 citric buffer, was performed prior to staining.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: mouse bladder
FH

Lindsey (Verified Customer) (05-24-2021)

Works beautifully! Looking forward to working more with this antibody in different tissue/prep types

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human kidney (FFPE)
Fibronectin Antibody Immunohistochemistry,Immunofluorescence validation (1:100 dilution) in Human kidney (FFPE) (Cat no:15613-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...