FOLR1 Polyclonal antibody

• 

  WB analysis of HeLa using 23355-1-AP

  WB result of FOLR1 antibody (23355-1-AP, 1:1000) with si-Control and si-FOLR1 transfected HeLa cells..

• 

  WB analysis using 23355-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23355-1-AP (FOLR1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 23355-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23355-1-AP (FOLR1 Antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 23355-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 23355-1-AP (FOLR1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 23355-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 23355-1-AP (FOLR1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 23355-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using FOLR1 antibody (23355-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

FOLR1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 23355-1-AP

Publications(16)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Folate receptor alpha, folate receptor 1 (adult), Folate receptor 1, FBP, Adult folate-binding protein

---

Tested Applications

• Positive WB detected in: HeLa cells, JAR cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 13 publications below
• IHC: See 2 publications below
• IF: See 5 publications below

Product Information

23355-1-AP targets FOLR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, camelus bactrianus
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19959

  Product name: Recombinant human FOLR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 55-93 aa of BC002947

  Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA

• Full Name: folate receptor 1 (adult)
• Calculated Molecular Weight: 257 aa, 30 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC002947
• Gene Symbol: FOLR1
• Gene ID (NCBI): 2348
• RRID: AB_2879264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15328
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	ACS Nano; Synchronization of Nanoparticle Sensitization and Radiosensitizing Chemotherapy through Cell Cycle Arrest Achieving Ultralow X-ray Dose Delivery to Pancreatic Tumors.; Authors - Divinah Manoharan
human,rat	WB	Adv Sci (Weinh); Hierarchical Targeting Nanodrug with Holistic DNA Protection for Effective Treatment of Acute Kidney Injury; Authors - Qiaohui Chen
human	WB	J Am Chem Soc; Cancer Selective Target Degradation by Folate-Caged PROTACs.; Authors - Jing Liu ; KD Validated
human	WB	ACS Appl Mater Interfaces; Design and Fabrication of Multifunctional Sericin Nanoparticles for Tumor Targeting and pH-Responsive Subcellular Delivery of Cancer Chemotherapy Drugs.; Authors - Lei Huang
human	WB	J Med Chem; Folate-Guided Protein Degradation by Immunomodulatory Imide Drug-Based Molecular Glues and Proteolysis Targeting Chimeras.; Authors - He Chen ; KD Validated
human	WB	BMC Cancer; Cancer-associated fibroblasts induce sorafenib resistance of hepatocellular carcinoma cells through CXCL12/FOLR1; Authors - Jiali Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Marvin (Verified Customer) (12-01-2022)

The antibody had non-specific staining of the cytosol of MDA-MB-231 cells while performing immunofluorescent analysis.

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1:50
• Cell Tissue Type: Monolayer of MDA-MB-231 cells

FOLR1 Antibody Western Blot,Immunofluorescence validation (1:50 dilution) in Monolayer of MDA-MB-231 cells (Cat no:23355-1-AP)