• Featured Product
  • KD/KO Validated

FOXD3 Polyclonal antibody

FOXD3 Polyclonal Antibody for WB, ELISA
Cat No. 27878-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

AIS1, forkhead box D3, Forkhead box protein D3, FOXD3, Genesis, HFH2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27878-1-AP targets FOXD3 in WB, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27260

Product name: Recombinant human FOXD3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-138 aa of NM_012183.2

Sequence: MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADEVPPAAPHHGQPQPPHQQPLTLPKEAAGAGAGPGGDVGAPEADGCKGGVGGEEGGASGGGPGAGSGSAGGLAPSKPKNS

Predict reactive species
Full Name forkhead box D3
Calculated Molecular Weight 48 kDa
Observed Molecular Weight57-60 kDa
GenBank Accession NumberNM_012183.2
Gene Symbol FOXD3
Gene ID (NCBI) 27022
RRIDAB_3086002
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UJU5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXD3, also named as HFH2, belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXD3 binds to the consensus sequence 5'-A[AT]T[AG]TTTGTTT-3' and acts as a transcriptional repressor. It also acts as a transcriptional activator. FOXD3 promotes development of neural crest cells from neural tube progenitors. It restricts neural progenitor cells to the neural crest lineage while suppressing interneuron differentiation. It required for maintenance of pluripotent cells in the pre-implantation and peri-implantation stages of embryogenesis. FOXD3 has one isoform produced by alternative splicing with the MW of 47 kDa. It can be detected as 57-60 kDa in some literature(PMID: 31940493).

Protocols

Product Specific Protocols
WB protocol for FOXD3 antibody 27878-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jelan (Verified Customer) (10-17-2025)

I have personally blotted for foxd3 a couple of times because we are working on foxd3 knockdowns specifically in cutaneous melanoma cell lines, by using this antibody for our blots we were able to confirm that the knockdowns worked and we were able to go forward with out assigned projects

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: cutaneous melanoma
FH

Haley (Verified Customer) (10-13-2025)

Reliable antibody, clear results.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Melanoma cell line
Loading...
||
New chat Able
正在加载,请稍候...