FPGS Polyclonal antibody

• 

  WB analysis using 27616-1-AP

  HeLa mitochondrial extracts were subjected to SDS PAGE followed by western blot with 27616-1-AP (FPGS antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 27616-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27616-1-AP (FPGS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 27616-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27616-1-AP (FPGS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 27616-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27616-1-AP (FPGS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 27616-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27616-1-AP (FPGS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FPGS Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27616-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Tetrahydrofolate synthase

---

Tested Applications

• Positive WB detected in: HeLa mitochondrial extract
• Positive IHC detected in: mouse kidney tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27616-1-AP targets FPGS in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24775

  Product name: Recombinant human FPGS protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 397-587 aa of BC064393

  Sequence: QGRERPSGGPEVRVLLFNATGDRDPAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSVPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSPPKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ

• Full Name: folylpolyglutamate synthase
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC064393
• Gene Symbol: FPGS
• Gene ID (NCBI): 2356
• RRID: AB_3669615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05932
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FPGS is located in the cytosol and mitochondria of mammalian tissues, with current evidence supporting a single gene encoding for both the cytosolic and mitochondrial isoenzymes. FPGS catalyzes a rate-limiting polyglutamylation step in the folic acid metabolic pathway and increases the intracellular retention of folates (PMID: 8907263, PMID: 31611592). FPGS has 4 isoforms with the molecular mass of 59-65 kDa.