Tested Applications
| Positive WB detected in | Caco-2 cells, mouse colon tissue, rat kidney tissue, HEK-293 cells, mouse colon tisue |
| Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 13 publications below |
| IF | See 1 publications below |
Product Information
24272-1-AP targets Frizzled 2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18003 Product name: Recombinant human FZD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 138-217 aa of BC113402 Sequence: CEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLG Predict reactive species |
| Full Name | frizzled homolog 2 (Drosophila) |
| Calculated Molecular Weight | 565 aa, 64 kDa |
| Observed Molecular Weight | 64-70 kDa |
| GenBank Accession Number | BC113402 |
| Gene Symbol | Frizzled 2 |
| Gene ID (NCBI) | 2535 |
| RRID | AB_2879463 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14332 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Frizzled 2(FZD2) also known as FzE2, which belongs to the G-protein coupled receptor Fz/Smo family. FZD2 is an important receptor in the Wnt pathway, which is highly expressed in malignant tumors and helps regulate multiple tumor behaviors. Its expression level is related to prognosis. Moreover, high level of FZD2 had significant correlation with poor prognosis in Breast cancer (BC) patients(PMID: 33832493).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Frizzled 2 antibody 24272-1-AP | Download protocol |
| WB protocol for Frizzled 2 antibody 24272-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biol Res Electroacupuncture promotes neurogenesis in the dentate gyrus and improves pattern separation in an early Alzheimer's disease mouse model | ||
Front Microbiol Expression and (Lacking) Internalization of the Cell Surface Receptors of Clostridioides difficile Toxin B. | ||
Pharm Biol Yiguanjian decoction inhibits macrophage M1 polarization and attenuates hepatic fibrosis induced by CCl4/2-AAF. | ||
Evid Based Complement Alternat Med Intervention Mechanism of Hunag-Lian Jie-Du Decoction on Canonical Wnt/β-Catenin Signaling Pathway in Psoriasis Mouse Model. | ||
Cell Death Discov Cholesterol activates the Wnt/PCP-YAP signaling in SOAT1-targeted treatment of colon cancer.
| ||
Genes Dis Depletion of VPS35 attenuates metastasis of hepatocellular carcinoma by restraining the Wnt/PCP signaling pathway. |











