Fas/CD95 Polyclonal antibody

• 

  WB analysis using 30601-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30601-1-AP (Fas/CD95 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30601-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30601-1-AP (Fas/CD95 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Raji using 30601-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using Fas/CD95 antibody (30601-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Fas/CD95 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30601-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Fas, CD95, TNFR6, APT1, APO 1

---

Tested Applications

• Positive WB detected in: Jurkat cells, J774A.1 cells, mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30601-1-AP targets Fas/CD95 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30426

  Product name: Recombinant mouse Fas/CD95 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-169 aa of NM_007987

  Sequence: QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR

• Full Name: Fas (TNF receptor superfamily member 6)
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: NM_007987
• Gene Symbol: Fas/CD95
• Gene ID (NCBI): 14102
• RRID: AB_3086371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25446
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAS, also named as CD95, APO-1, APT1, FAS1 and TNFRSF6, is a receptor for TNFSF6/FASLG. It is a cell surface receptor belonging to the TNF receptor superfamily, can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Immunol; Ganoderma lucidum spore powder alleviates rheumatoid arthritis-associated pain hypersensitivity through inhibiting accumulation, N1 polarization, and ROS production of neutrophils in mice; Authors - Sen Huang