G-CSF Polyclonal antibody

• 

  WB analysis using 17185-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17185-1-AP (G-CSF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17185-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17185-1-AP (G-CSF antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17185-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17185-1-AP (G-CSF antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  FC experiment of K-562 using 17185-1-AP

  1X10^6 K-562 cells were intracellularly stained with 0.4 ug Anti-Human G-CSF (17185-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

G-CSF Polyclonal Antibody for WB, ELISA, FC (Intra)

Cat No. 17185-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA, FC (Intra)

Synonyms

C17orf33, CSF3, Filgrastim, G CSF, GCSF, G-CSF, Lenograstim, Pluripoietin

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MOLT-4 cells, MCF-7 cells, K-562 cells
• Positive FC (Intra) detected in: K-562 cells
• Positive FC detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

17185-1-AP targets G-CSF in WB, IHC, ELISA, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10968

  Product name: Recombinant human G-CSF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC033245

  Sequence: MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

• Full Name: colony stimulating factor 3 (granulocyte)
• Calculated Molecular Weight: 200 aa, 22 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC033245
• Gene Symbol: G-CSF
• Gene ID (NCBI): 1440
• RRID: AB_2878357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09919
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Granulocyte colony-stimulating factor (G-CSF), also referred to as CSF3, is a protective cytokine with anti-inflammatory effects. G-CSF is important in promoting survival of the granulocytic lineage cells and proliferation and migration of neutrophils as well as trophoblast cells. G-CSF acts by binding to its receptor G-CSFR (also called CSF3R), which after binding with G-CSF activates the canonical Janus kinase (Jak)/signal transducer, activator of transcription (STAT)and Ras/Raf/MAP kinase pathways. G-CSF potently stimulates the proliferation and release of peripheral blood progenitor cells into the bloodstream and is therefore used to treat neutropenia after chemotherapy. Furthermore, G-CSF levels are elevated upon intensive exercise leading to increased neutrophil counts, which are predominantly due to delayed neutrophil apoptosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Mol Immunol; Granulocyte colony stimulating factor (G-CSF) regulates neutrophils infiltration and periodontal tissue destruction in an experimental periodontitis.; Authors - Zheng Zhang
human	WB,IHC	Int J Mol Sci; A NOTCH1 Mutation Found in a Newly Established Ovarian Cancer Cell Line (FDOVL) Promotes Lymph Node Metastasis in Ovarian Cancer; Authors - Wei Jiang ; KD Validated