Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

G3BP1 Polyclonal antibody

G3BP1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 13057-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA

ATP-dependent DNA helicase VIII, EC:3.6.4.12, G3BP, G3BP 1, G3BP-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, HEK-293 cells, human brain tissue, Neuro-2a cells, Jurkat cells, MCF-7 cells, HeLa cells, mouse kidney tissue, rat kidney tissue, mouse brain tissue, rat brain tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue, human colorectal cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected insodium arsenite treated HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13057-2-AP targets G3BP1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, zebrafish, drosophila melanogaster (fruit fly)
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3728

Product name: Recombinant human G3BP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 167-466 aa of BC006997

Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ

Predict reactive species
Full Name GTPase activating protein (SH3 domain) binding protein 1
Calculated Molecular Weight 466 aa, 52 kDa
Observed Molecular Weight68 kDa
GenBank Accession NumberBC006997
Gene Symbol G3BP1
Gene ID (NCBI) 10146
RRIDAB_2232034
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13283
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology.

Protocols

Product Specific Protocols
FC protocol for G3BP1 antibody 13057-2-APDownload protocol
IF protocol for G3BP1 antibody 13057-2-APDownload protocol
IHC protocol for G3BP1 antibody 13057-2-APDownload protocol
IP protocol for G3BP1 antibody 13057-2-APDownload protocol
WB protocol for G3BP1 antibody 13057-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouse,human,chickenIF,CoIP

Cell

Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules

Authors - Qinqin Cui
humanIF

Nature

m6A enhances the phase separation potential of mRNA.

Authors - Ryan J Ries
humanIP,IF

Science

Ubiquitination of G3BP1 mediates stress granule disassembly in a context-specific manner.

Authors - Youngdae Gwon
humanIF

Cell

ELAVL4, splicing, and glutamatergic dysfunction precede neuron loss in MAPT mutation cerebral organoids.

Authors - Kathryn R Bowles
humanIF

Cell

RNA Granules Hitchhike on Lysosomes for Long-Distance Transport, Using Annexin A11 as a Molecular Tether.

Authors - Ya-Cheng Liao
humanIF

Cell

Phase Separation of FUS Is Suppressed by Its Nuclear Import Receptor and Arginine Methylation.

Authors - Mario Hofweber

Reviews

    5.0 out of 5
Add a review

21 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Vasudevarao (Verified Customer) (04-09-2026)

Antibody works well for western blot in 1:1000 dilution, incubated overnight in 3%BSA/PBS on human lung cancer cell lines.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Prostate cancer cells

Prakash (Verified Customer) (10-17-2025)

working very well in western blot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000 for western
  • Cell Tissue Type: T24 Bladder cancer cell

lu (Verified Customer) (09-18-2025)

Good antibody for flow cytometry

  • Applications: Flow Cytometry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: OPM2

Nikolett (Verified Customer) (07-29-2025)

Antibody works well for western blot in 1:1000 dilution, incubated overnight in 3%BSA/PBS on human lung cancer cell lines.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human Lung Cancer Patient Derived Cell Lines

Xiaochen (Verified Customer) (11-11-2024)

  • Applications: Immunofluorescence
G3BP1 Antibody Immunofluorescence validation ( dilution) in (Cat no:13057-2-AP)

Xiaochen (Verified Customer) (11-11-2024)

  • Applications: Immunofluorescence
  • Cell Tissue Type: SH-SY5Y
G3BP1 Antibody Immunofluorescence validation ( dilution) in SH-SY5Y (Cat no:13057-2-AP)

Roy (Verified Customer) (06-12-2024)

Works great on WB (1/1000 - Overnight 4°C) - Very beautiful IF staining in non stressed (diffuse staining) and Sodium Arsenite-mediated Stress induction (Punctate staining corresponding to stress granules) in HeLa cells (1/250 - 1h at RT).

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa

Vinny (Verified Customer) (02-20-2024)

Good product.

  • Applications: Immunofluorescence

Andrea (Verified Customer) (10-05-2023)

Good and strong signal.

  • Applications: Western Blot

Tatyana (Verified Customer) (01-21-2023)

Used for IP and WB of GFP-tagged overexpressed human G3BP1 (HEK293 cells). Lysates were subjected to IP using GFP-Trap beads. WB was done using semi-dry transfer. Antibody was used in 4% milk in TBST at 1:1,000 dilution. It could be reused up to 3 times. As the image shows, the antibody can successfully detect both endogenous and OE protein.

  • Applications: Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293
G3BP1 Antibody Immunofluorescence,Immunoprecipitation validation (1:1000 dilution) in HEK293 (Cat no:13057-2-AP)

Tobias (Verified Customer) (10-25-2022)

  • Applications: Western Blot

Peter (Verified Customer) (10-24-2022)

Best G3BP1 antibody I've used for Western, IF and IP

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000 for WB. 1:200 for IF
  • Cell Tissue Type: A549 and U2OS

Patryk (Verified Customer) (03-18-2021)

I used the antibody for immunofluorescence imaging to label stress granules induced by treating the cells with with 50µM sodium arsenite. Used the antibody at a dilution 1:100 overnight at 4°C. Worked perfectly well, strong and specific signal. I am very satisfied of this antibody and strongly recommend if for immunofluorescence.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: HCT116 cells
G3BP1 Antibody Immunofluorescence validation (1:100 dilution) in HCT116 cells (Cat no:13057-2-AP)

Kun (Verified Customer) (03-23-2020)

Very specific and sensitive

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000

Biao (Verified Customer) (03-11-2020)

This antibody is very specific and good quality.

  • Applications: Western Blot,
  • Cell Tissue Type: hct-116

Joshua (Verified Customer) (12-28-2019)

PANC1 cells fixed in 4% paraformaldehdye. Bright localization to stress granules.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: human pancreatic adenocarcinoma cells
G3BP1 Antibody Immunofluorescence, validation (1:500 dilution) in human pancreatic adenocarcinoma cells (Cat no:13057-2-AP)

Yuan (Verified Customer) (11-02-2019)

Very bright staining for stress granule on NaAsO2 treated Hela cells. 1:500 should be sufficient for IF staining.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Hela
G3BP1 Antibody Immunofluorescence, validation (1:250 dilution) in Hela (Cat no:13057-2-AP)

Zeinab (Verified Customer) (08-19-2019)

It worked great

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:400

Erica (Verified Customer) (05-15-2019)

Our lab has been using this antibody for IP, WB and IF for many years and it always worked well. I highly recommend this antibody, especially for IP for stress granules.

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation,
  • Cell Tissue Type: HeLa; MEF

Karthik (Verified Customer) (04-24-2019)

Upon induction of sodium arsenite stress in neurons G3BP1 positive stress granules formed in 90 minutes.Cells permeabilized with 0.2% triton for 10 minutes

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1: 500 overnight at 4 degrees
  • Cell Tissue Type: Primary motor neurons
G3BP1 Antibody Immunofluorescence, validation (1: 500 overnight at 4 degrees dilution) in Primary motor neurons (Cat no:13057-2-AP)

Tian (Verified Customer) (01-23-2019)

I used it for ICC and it worked Great.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1;100
  • Cell Tissue Type: NIH3T3
Loading...
||
New chat

Able

正在加载,请稍候...