Recombinant human GAST protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag12795
Synonyms
GAS
Validation Data Gallery View All
Product Information
| Peptide Sequence |
SEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
(19-101 aa encoded by BC069724) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
