Tested Applications
Positive WB detected in | HUVEC cells |
Positive IHC detected in | mouse cerebellum tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
30719-1-AP targets GBP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag33889 Product name: Recombinant human GBP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 535-595 aa of BC140837 Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI* Predict reactive species |
Full Name | guanylate binding protein 3 |
Observed Molecular Weight | 68 kDa |
GenBank Accession Number | BC140837 |
Gene Symbol | GBP3 |
Gene ID (NCBI) | 2635 |
RRID | AB_3086400 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H0R5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Guanylate-binding protein 3 (GBP3) is involved in the proliferation of glioma cells through regulating SQSTM1-ERK1/2 pathway. GBP3 has 2 isoforms, one is 595 amino acids long at 68 kDa and the other is at nearly 62 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GBP3 antibody 30719-1-AP | Download protocol |
IHC protocol for GBP3 antibody 30719-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |