Tested Applications
Positive WB detected in | mouse liver tissue, mouse heart tissue |
Positive IHC detected in | human liver tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 6 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
Product Information
26784-1-AP targets GCGR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24861 Product name: Recombinant human GCGR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 91-141 aa of BC104854 Sequence: VQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSF Predict reactive species |
Full Name | glucagon receptor |
Calculated Molecular Weight | 477 aa, 54 kDa |
Observed Molecular Weight | 62-68 kDa |
GenBank Accession Number | BC104854 |
Gene Symbol | GCGR |
Gene ID (NCBI) | 2642 |
RRID | AB_2880634 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P47871 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glucagon receptor (GCGR) is a secretin-like (class B) family of G-protein coupled receptors (GPCRs). It plays an important role in elevating the glucose concentration in the blood and has thus become one of the promising therapeutic targets for treating type 2 diabetes mellitus (PMID: 26236379). GCGR is a 62-kDa glycoprotein that contains at least four N-linked oligosaccharide chains (PMID: 2174441; 15245877). Defects in the gene of GCGR cause non-insulin-dependent diabetes mellitus (NIDDM).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GCGR antibody 26784-1-AP | Download protocol |
IHC protocol for GCGR antibody 26784-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
iScience Pro-α-cell-derived β-cells contribute to β-cell neogenesis induced by antagonistic glucagon receptor antibody in type 2 diabetic mice. | ||
J Gastroenterol Hepatol Irisin Alleviates Impaired Mitochondrial Fusion via Enhancing PKA/SIRT3/mTOR Pathway in Hepatic Steatosis | ||
Mol Cell Endocrinol Mof acetyltransferase inhibition ameliorates glucose intolerance and islet dysfunction of type 2 diabetes via targeting pancreatic α-cells. | ||
Am J Physiol Endocrinol Metab Glucagon receptor blockage inhibits β-cell dedifferentiation through FoxO1 | ||
Biomed Pharmacother Si-Miao-Yong-An decoction preserves cardiac function and regulates GLC/AMPK/NF-κB and GLC/PPARα/PGC-1α pathways in diabetic mice |