GET4 Polyclonal antibody

• 

  WB analysis using 27768-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27768-1-AP (GET4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 27768-1-AP

  HEK-293 cells and MCF-7 cells were subjected to SDS PAGE followed by western blot with 27768-1-AP (GET4 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 27768-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27768-1-AP (GET4 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 27768-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27768-1-AP (GET4 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human colon using 27768-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27768-1-AP (GET4 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 27768-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27768-1-AP (GET4 antibody) at dilution of 1:200 (under 40x lens).

GET4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27768-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

C7orf20, CEE, CGI 20, CGI-20, Conserved edge-expressed protein

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, HeLa cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

27768-1-AP targets GET4 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26904

  Product name: Recombinant human C7orf20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 5-141 aa of BC003550

  Sequence: AAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDA

• Full Name: chromosome 7 open reading frame 20
• Calculated Molecular Weight: 327 aa, 37 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC003550
• Gene Symbol: GET4
• Gene ID (NCBI): 51608
• RRID: AB_2880967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L5D6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Cell Biol; SMN-primed ribosomes modulate the translation of transcripts related to spinal muscular atrophy.; Authors - Fabio Lauria
human	WB	EMBO Rep; C9orf72 protein quality control by UBR5-mediated heterotypic ubiquitin chains; Authors - Julia Jülg

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

WEI (Verified Customer) (03-08-2022)

Band at right size with moderate background.

• Applications: Western Blot
• Cell Tissue Type: Mouse Heart