Recombinant human GNAQ protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag26170
Synonyms
GNAQ, CMC1, G ALPHA q, GAQ, Guanine nucleotide-binding protein alpha-q
Validation Data Gallery View All
Product Information
| Peptide Sequence |
FTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVD
(84-205 aa encoded by BC057777) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
