• Featured Product
  • KD/KO Validated

GNB3 Monoclonal antibody

GNB3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67497-1-Ig
Clone No.2B6E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

2B6E1, Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhTERT-RPE1 cells, HepG2 cells, L02 cells, pig brain tissue, rat retina tissue, Raji cells, Ramos cells, Daudi cells, RKO cells, Karpas-422 cells, IMR-32 cells, Rat brain cells, Mouse brain cells, rat brain tissue, mouse brain tissue
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67497-1-Ig targets GNB3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7050

Product name: Recombinant human GNB3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 3-340 aa of BC002454

Sequence: EMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESIICSITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN

Predict reactive species
Full Name guanine nucleotide binding protein (G protein), beta polypeptide 3
Calculated Molecular Weight 37 kDa
Observed Molecular Weight 35-37 kDa
GenBank Accession NumberBC002454
Gene Symbol GNB3
Gene ID (NCBI) 2784
RRIDAB_2882721
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP16520
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.

Protocols

Product Specific Protocols
WB protocol for GNB3 antibody 67497-1-IgDownload protocol
IHC protocol for GNB3 antibody 67497-1-IgDownload protocol
IF protocol for GNB3 antibody 67497-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...