GNB3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67497-1-Ig (same clone as 67497-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67497-1-Ig (GNB3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67497-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67497-1-Ig (same clone as 67497-1-PBS)

  WB result of GNB3 antibody (67497-1-Ig; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-GNB3 transfected HepG2 cells. This data was developed using the same antibody clone with 67497-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67497-1-Ig (same clone as 67497-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67497-1-Ig (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67497-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 67497-1-Ig (same clone as 67497-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 67497-1-Ig (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67497-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67497-1-Ig (same clone as 67497-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67497-1-Ig (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67497-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat retina using 67497-1-Ig (same clone as 67497-1-PBS)

  rat retina tissue were subjected to SDS PAGE followed by western blot with 67497-1-Ig (GNB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67497-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67497-1-Ig (same clone as 67497-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67497-1-Ig (GNB3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67497-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67497-1-Ig (same clone as 67497-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67497-1-Ig (GNB3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67497-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67497-1-Ig (same clone as 67497-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GNB3 antibody (67497-1-Ig, Clone: 2B6E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67497-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GNB3 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67497-1-PBS

Clone No.2B6E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

2B6E1, Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3

---

Product Information

67497-1-PBS targets GNB3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7050

  Product name: Recombinant human GNB3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 3-340 aa of BC002454

  Sequence: EMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESIICSITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN

• Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 3
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC002454
• Gene Symbol: GNB3
• Gene ID (NCBI): 2784
• RRID: AB_2882721
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P16520
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Guanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.