Product Information
13416-1-PBS targets GPR17 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4106 Product name: Recombinant human GPR17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC031653 Sequence: VPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL Predict reactive species |
Full Name | G protein-coupled receptor 17 |
Calculated Molecular Weight | 367 aa, 41 kDa |
GenBank Accession Number | BC031653 |
Gene Symbol | GPR17 |
Gene ID (NCBI) | 2840 |
RRID | AB_2279341 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13304 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
GPR17 is a G protein-coupled receptor (GPCR) that plays a significant role in various physiological processes, particularly in the central nervous system (CNS). GPR17 is considered a modulator of CNS myelination and is involved in reconstructing and repairing demyelinating plaques caused by ongoing inflammatory processes, such as in multiple sclerosis (MS). It is present in nerve cells and precursor oligodendrocyte cells, playing a role in the differentiation and maturation of oligodendrocytes (PMID: 32182666). GPR17 is a multifaceted GPCR with implications in immune regulation, glucose metabolism, neurodegenerative diseases, and potentially in treating anxiety disorders.