GPS2 Polyclonal antibody

• 

GPS2 Polyclonal Antibody for ELISA

Cat No. 12177-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

AMF 1, G protein pathway suppressor 2, GPS 2, GPS2

---

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

12177-1-AP targets GPS2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2821

  Product name: Recombinant human GPS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-327 aa of BC013652

  Sequence: MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK

• Full Name: G protein pathway suppressor 2
• Calculated Molecular Weight: 327 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC013652
• Gene Symbol: GPS2
• Gene ID (NCBI): 2874
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13227
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,human	WB,IHC	Respir Res; GPS2 ameliorates cigarette smoking-induced pulmonary vascular remodeling by modulating the ras-Raf-ERK axis; Authors - Ting Hu