GPSM2 Recombinant monoclonal antibody, PBS Only

GPSM2 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86175-1-PBS
Clone No.250793G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

G protein signaling modulator 2, G-protein-signaling modulator 2, LGN, Pins

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86175-1-PBS targets GPSM2 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25195

Product name: Recombinant human GPSM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 559-600 aa of BC027732

Sequence: FSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDILVKCQGS

Predict reactive species
Full Name G-protein signaling modulator 2 (AGS3-like, C. elegans)
Calculated Molecular Weight 75 kDa
Observed Molecular Weight70-77 kDa
GenBank Accession NumberBC027732
Gene Symbol GPSM2
Gene ID (NCBI) 29899
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP81274
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GPSM2 belongs to a family of proteins that modulate activation of G proteins. GPSM2 assists in the exchange of guanine nucleotides, and allows extracellular signals to be transmitted to cells via cell surface, and ultimately plays a key role in the activation of G-proteins. Therefore, GPSM2 is a critical factor for the stability of cell division. Some recent studies have shown that GPSM2 messenger RNA (mRNA) is overexpressed and plays a positive role in the development of certain tumors, such as liver cancer, pancreatic cancer, breast cancer. It also plays a role in neuroblast division and in the development of normal hearing. Mutations in GPSM2 are associated with autosomal recessive nonsyndromic deafness (DFNB82), which is a form of non-syndromic deafness characterized by prelingual, bilateral, severe, sensorineural hearing loss.

Loading...
||
New chat

Able

正在加载,请稍候...