GPSM2 Recombinant monoclonal antibody

GPSM2 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86175-1-RR
Clone No.250793G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

G protein signaling modulator 2, G-protein-signaling modulator 2, LGN, Pins

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HEK-293 cells, mouse liver tissue, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86175-1-RR targets GPSM2 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25195

Product name: Recombinant human GPSM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 559-600 aa of BC027732

Sequence: FSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDILVKCQGS

Predict reactive species
Full Name G-protein signaling modulator 2 (AGS3-like, C. elegans)
Calculated Molecular Weight 75 kDa
Observed Molecular Weight70-77 kDa
GenBank Accession NumberBC027732
Gene Symbol GPSM2
Gene ID (NCBI) 29899
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP81274
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPSM2 belongs to a family of proteins that modulate activation of G proteins. GPSM2 assists in the exchange of guanine nucleotides, and allows extracellular signals to be transmitted to cells via cell surface, and ultimately plays a key role in the activation of G-proteins. Therefore, GPSM2 is a critical factor for the stability of cell division. Some recent studies have shown that GPSM2 messenger RNA (mRNA) is overexpressed and plays a positive role in the development of certain tumors, such as liver cancer, pancreatic cancer, breast cancer. It also plays a role in neuroblast division and in the development of normal hearing. Mutations in GPSM2 are associated with autosomal recessive nonsyndromic deafness (DFNB82), which is a form of non-syndromic deafness characterized by prelingual, bilateral, severe, sensorineural hearing loss.

Protocols

Product Specific Protocols
WB protocol for GPSM2 antibody 86175-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...