GPT/ALT1 Monoclonal antibody, PBS Only

• 

  WB analysis of rat liver using 67531-1-Ig (same clone as 67531-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67531-1-Ig (GPT/ALT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67531-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67531-1-Ig (same clone as 67531-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67531-1-Ig (GPT/ALT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67531-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 67531-1-Ig (same clone as 67531-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 67531-1-Ig (GPT/ALT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67531-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 67531-1-Ig (same clone as 67531-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 67531-1-Ig (GPT antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67531-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 67531-1-Ig (same clone as 67531-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67531-1-Ig (GPT antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67531-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67531-1-Ig (same clone as 67531-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GPT antibody (67531-1-Ig, Clone: 5F6B5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67531-1-PBS in a different storage buffer formulation.

GPT/ALT1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67531-1-PBS

Clone No.5F6B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ALAT1, GPT, GPT/ ALT1, AAT1, Alanine aminotransferase 1

---

Product Information

67531-1-PBS targets GPT/ALT1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10453

  Product name: Recombinant human GPT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 147-496 aa of BC018207

  Sequence: IPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLEYS

• Full Name: glutamic-pyruvate transaminase (alanine aminotransferase)
• Calculated Molecular Weight: 496 aa, 55 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC018207
• Gene Symbol: ALT1
• Gene ID (NCBI): 2875
• RRID: AB_2882750
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24298
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPT, also known as ALT1 (glutamate-pyruvate transaminase 1), catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.