GPT/ALT1 Monoclonal antibody, PBS Only

GPT/ALT1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 67531-1-PBS
Clone No.5F6B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Indirect ELISA

ALAT1, GPT, GPT/ ALT1, AAT1, Alanine aminotransferase 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67531-1-PBS targets GPT/ALT1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10453

Product name: Recombinant human GPT protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 147-496 aa of BC018207

Sequence: IPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLEYS

Predict reactive species
Full Name glutamic-pyruvate transaminase (alanine aminotransferase)
Calculated Molecular Weight 496 aa, 55 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC018207
Gene Symbol ALT1
Gene ID (NCBI) 2875
RRIDAB_2882750
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24298
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GPT, also known as ALT1 (glutamate-pyruvate transaminase 1), catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.

Loading...
||
New chat Able
正在加载,请稍候...