GSTA4 Polyclonal antibody

• 

  WB analysis of human brain using 17271-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17271-1-AP (GSTA4 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 17271-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17271-1-AP (GSTA4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of SH-SY5Y using 17271-1-AP

  IP result of anti-GSTA4 (IP:17271-1-AP, 4ug; Detection:17271-1-AP 1:500) with SH-SY5Y cells lysate 1600ug.

• 

  IF Staining of HEK-293 using 17271-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using 17271-1-AP (GSTA4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

GSTA4 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 17271-1-AP

Publications(10)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:2.5.1.18, Glutathione S transferase A4, Glutathione S transferase A4 4, Glutathione S-transferase A4, Glutathione S-transferase A4-4

---

Tested Applications

• Positive WB detected in: human brain tissue
• Positive IP detected in: SH-SY5Y cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IHC: See 1 publications below

Product Information

17271-1-AP targets GSTA4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11028

  Product name: Recombinant human GSTA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-222 aa of BC015523

  Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

• Full Name: glutathione S-transferase alpha 4
• Calculated Molecular Weight: 222 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC015523
• Gene Symbol: GSTA4
• Gene ID (NCBI): 2941
• RRID: AB_2295133
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15217
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSTA4 (Glutathione S-Transferase Alpha 4) is an enzyme that plays a key role in detoxification and antioxidant defense. Its structure includes a GSH-binding site and a hydrophobic substrate-binding domain, functioning as a dimer. Dysregulation of GSTA4 is linked to diseases like cancer, neurodegeneration, and diabetes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis.; Authors - Dong Huang
human	WB	Free Radic Biol Med; Increased hepatocellular protein carbonylation in human end-stage alcoholic cirrhosis.; Authors - C T Shearn
mouse	WB	Mech Ageing Dev; WDR23 mediates NRF2 proteostasis and cytoprotective capacity in the hippocampus; Authors - Jiahui Liu
mouse	WB	J Lipid Res; Susceptibility of L-FABP-/- mice to oxidative stress in early-stage alcoholic liver.; Authors - Rebecca L Smathers
		PLoS One; Short term feeding of a high fat diet exerts an additive effect on hepatocellular damage and steatosis in liver-specific PTEN knockout mice.; Authors - Colin T Shearn
human	WB	Exp Mol Pathol; Dysregulation of antioxidant responses in patients diagnosed with concomitant Primary Sclerosing Cholangitis/Inflammatory Bowel Disease.; Authors - Colin T Shearn

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Iru (Verified Customer) (10-04-2021)

The antibody works well

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Fallopian tube epithelial cells