GYS1 Polyclonal antibody

• 

  WB analysis using 10566-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10566-1-AP (GYS1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 10566-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10566-1-AP (GYS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 10566-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10566-1-AP (GYS1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 10566-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10566-1-AP (GYS1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human skeletal muscle using 10566-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10566-1-AP (GYS1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 10566-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10566-1-AP (GYS1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human prostate cancer using 10566-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10566-1-AP (GYS1 antibody) at dilution of 1:50 (under 25x lens).

• 

  IF Staining of HepG2 using 10566-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GYS1 antibody (10566-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

GYS1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10566-1-AP

Publications(22)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

GS, Glycogen synthase1, glycogen synthase 1 (muscle), Glycogen synthase 1, Glycogen

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, Jurkat cells, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue
• Positive IHC detected in: human liver tissue, human skeletal muscle tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 17 publications below
• IHC: See 6 publications below
• IF: See 1 publications below

Product Information

10566-1-AP targets GYS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0857

  Product name: Recombinant human GYS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-737 aa of BC007688

  Sequence: RAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN

• Full Name: glycogen synthase 1 (muscle)
• Calculated Molecular Weight: 84 kDa
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC007688
• Gene Symbol: GYS1
• Gene ID (NCBI): 2997
• RRID: AB_2116401
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13807
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GYS1(Glycogen [starch] synthase, muscle) is the the rate limiting enzyme of the insulin-induced glycogenesis, transferring glucose units from UDP-Glc to a glycogen primer. It catalyzes the linear addition of glucose residues to the branching structure of glycogen, providing a convenient store of glucose for times of metabolic need. This protein has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Biol Sci; PYGL-mediated glucose metabolism reprogramming promotes EMT phenotype and metastasis of pancreatic cancer; Authors - Qian Ji
human	WB,IHC	J Invest Dermatol; Enhanced Glycogen Metabolism Supports the Survival and Proliferation of HPV-Infected Keratinocytes in Condylomata Acuminata.; Authors - Zhichao Gu ; KD Validated
mouse	WB	Arterioscler Thromb Vasc Biol; Inducible metabolic adaptation promotes mesenchymal stem cell therapy for ischemia: a hypoxia-induced and glycogen-based energy prestorage strategy.; Authors - Hongming Zhu
rat	WB	Metabolism; Recurrent hypoglycemia increases hepatic gluconeogenesis without affecting glycogen metabolism or systemic lipolysis in rat; Authors - Zejian Liu
mouse	WB	J Ethnopharmacol; Si-Ni-San promotes liver regeneration by maintaining hepatic oxidative equilibrium and glucose/lipid metabolism homeostasis; Authors - Xu Yang
mouse	WB	Mol Nutr Food Res; Douchi Peptides Vy and Sfllr Improve Glucose Homeostasis and Gut Dysbacteriosis In High-Fat Diet-Induced Insulin Resistant Mice; Authors - Songfeng Yu