• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated GYS1 Polyclonal antibody

GYS1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-10566

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

GS, Glycogen synthase1, glycogen synthase 1 (muscle), Glycogen synthase 1, Glycogen

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-10566 targets GYS1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0857

Product name: Recombinant human GYS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 430-737 aa of BC007688

Sequence: RAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN

Predict reactive species
Full Name glycogen synthase 1 (muscle)
Calculated Molecular Weight 84 kDa
Observed Molecular Weight 84 kDa
GenBank Accession NumberBC007688
Gene Symbol GYS1
Gene ID (NCBI) 2997
RRIDAB_2934825
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP13807
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GYS1(Glycogen [starch] synthase, muscle) is the the rate limiting enzyme of the insulin-induced glycogenesis, transferring glucose units from UDP-Glc to a glycogen primer. It catalyzes the linear addition of glucose residues to the branching structure of glycogen, providing a convenient store of glucose for times of metabolic need. This protein has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 GYS1 antibody CL647-10566Download protocol
FC protocol for CL Plus 647 GYS1 antibody CL647-10566Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...