• Featured Product
  • KD/KO Validated

HDAC1 Polyclonal antibody

HDAC1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10197-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

RPD3, histone deacetylase 1, HD1, GON 10, EC:3.5.1.98

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, HeLa cells, mouse testis tissue, Jurkat cells, K-562 cells, NIH/3T3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman pancreas cancer tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:8000-1:20000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10197-1-AP targets HDAC1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0256

Product name: Recombinant human HDAC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 184-482 aa of BC000301

Sequence: EEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Predict reactive species
Full Name histone deacetylase 1
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC000301
Gene Symbol HDAC1
Gene ID (NCBI) 3065
RRIDAB_2118062
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13547
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Background

Histone Deacetylase 1 (HDAC1) is a nuclear localized class I histone deacetylase that plays a role in the regulation of gene expression, mainly by repression of gene activity. Additionally, HDAC can mediate deacetylation of a subset of non-histone proteins, leading to their degradation. HDAC1 activity has an impact on cell growth, proliferation, and death.

 

1. What is the molecular weight of HDAC1?

The molecular size of HDAC1 is 60 kDa.

2. What is the subcellular localization of HDAC1?

Unlike some HDACs, HDAC1 is present entirely in the nucleus. Our HDAC1 antibody has been broadly tested for IF/ICC.

3. I cannot detect an HDAC1 specific signal in my sample during western blotting.

Make sure that you efficiently extract nuclear proteins during your sample preparation. Some lysis buffers (e.g., based on Triton X-100) may not extract nuclear proteins. We recommend using RIPA buffer (https://www.ptglab.com/support/protocols/). We highly recommend using nuclear loading control antibodies, such as lamin B1 or PCNA (https://www.ptglab.com/news/blog/loading-control-antibodies-for-western-blotting/). Alternatively, you may consider performing cell fractionation.

4. How do I perform chromatin immunoprecipitation (ChiP) with the HDAC1 antibody?

We recommend using our standard chromatin immunoprecipitation protocol (https://www.ptglab.com/media/2708/web_chip-protocol.pdf).

5. Is HDAC1 post-translationally modified?

HDAC1 is a protein deacetylase but itself can also be a subject of post-translational modifications, including phosphorylation, acetylation, ubiquitination, SUMOylation, nitrosylation, and carbonylation (PMID: 21197454).

6. What is the role of HDAC1 in cancer?

The acetylation and deacetylation of histones play an important part in the epigenetic regulation of gene expression. Alterations in the balance between these two opposing processes changes chromosome remodeling and increased deacetylation leads to gene silencing. HDAC1 levels are increased in many cancer cell types and the role of HDAC1 in cancer is connected not only to histone deacetylation but also to the deacetylation of other proteins, such as Rb family proteins, estrogen receptors, and p53 protein (PMID: 19383284).


Protocols

Product Specific Protocols
WB protocol for HDAC1 antibody 10197-1-APDownload protocol
IHC protocol for HDAC1 antibody 10197-1-APDownload protocol
IF protocol for HDAC1 antibody 10197-1-APDownload protocol
IP protocol for HDAC1 antibody 10197-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratIP

Cell Metab

Sphingolipid metabolism controls mammalian heart regeneration

Authors - Xiaoqian Ji
humanWB

Acta Pharm Sin B

Histone deacetylase inhibitors inhibit cervical cancer growth through Parkin acetylation-mediated mitophagy.

Authors - Xin Sun
mouseWB

J Clin Invest

Acetaldehyde dehydrogenase 2 interactions with LDLR and AMPK regulate foam cell formation.

Authors - Shanshan Zhong
humanWB

Nat Commun

PCGF6 controls neuroectoderm specification of human pluripotent stem cells by activating SOX2 expression.

Authors - Xianchun Lan
mouseIP

Nat Commun

The methyltransferase METTL3 negatively regulates nonalcoholic steatohepatitis (NASH) progression.

Authors - Xinzhi Li
humanWB,IHC

Hepatology

PROX1 promotes hepatocellular carcinoma metastasis by way of up-regulating hypoxia-inducible factor 1α expression and protein stability.

Authors - Liu Yanfeng Y

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sara (Verified Customer) (10-06-2024)

I tried WB and FC with mouse cells, works well. I still need to give it a try for immunofluorescence, but it seems to work as well based on other reviews.

  • Applications: Western Blot, Flow Cytometry
  • Cell Tissue Type: Mouse cells
FH

Mi (Verified Customer) (06-25-2023)

Works pretty well in human adipocyte cells.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: human white adipocytes
FH

Christos (Verified Customer) (04-03-2023)

Separating Gel: 10% poly-acrylamide Transfer at 400mA for 2hr onto nitrocellulose membrane at 4oC Blocking and antibodies dilutions: 5% non-fat milk in PBS-Tween20 for 1hr Incubation with primary Abs: overnight at 4oC Incubation with secondary Abs: 1hr at 4oC

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Human cervix carcinoma cells/ HeLe Kyoto
HDAC1 Antibody Western Blot validation (1/1000 dilution) in Human cervix carcinoma cells/ HeLe Kyoto (Cat no:10197-1-AP)
FH

Dipen (Verified Customer) (07-20-2020)

Great antibody for Western blotting.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hippocampal neurons
HDAC1 Antibody Western Blot, validation (1:1000 dilution) in Hippocampal neurons (Cat no:10197-1-AP)
FH

Uxoa (Verified Customer) (02-19-2020)

HDAC1 in human primary fibroblasts untreated vs treated. Cells fixed with 4% PFA 15 min RT. HDAC1 incubation 1:50 in PBST (0.1% triton) + 10% DS O/N 4ºC. Donkey anti-rabbit Alexa fluor 555 1:500 1h RT.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Human fibroblasts
HDAC1 Antibody Immunofluorescence, validation (1:50 dilution) in Human fibroblasts (Cat no:10197-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...