Tested Applications
| Positive WB detected in | A549 cells, Calu-1 cells, NCI-H1299 cells, HEK-293 cells, HeLa cells, HepG2 cells, L02 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human tonsillitis tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:5000-1:20000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15240-1-AP targets HLA class I ABC in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA, Cell treatment applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7370 Product name: Recombinant human HLA class I (HLA-A) protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-302 aa of BC003069 Sequence: MRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS Predict reactive species |
| Full Name | major histocompatibility complex, class I, A |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 44 kDa |
| GenBank Accession Number | BC003069 |
| Gene Symbol | HLA-A |
| Gene ID (NCBI) | 3105 |
| RRID | AB_1557426 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04439 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. (PMID: 667938; 3375250)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HLA class I ABC antibody 15240-1-AP | Download protocol |
| IHC protocol for HLA class I ABC antibody 15240-1-AP | Download protocol |
| IP protocol for HLA class I ABC antibody 15240-1-AP | Download protocol |
| WB protocol for HLA class I ABC antibody 15240-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HLA class I ABC Polyclonal antibody (Cat# 15240-1-AP) has accumulated 90 citations in high-impact journals including Nature, Cell, Nat Med, Nat Commun, Cancer Discov, J Immunother Cancer, and PNAS. Research fields encompass cancer immunology (MHC-I antigen presentation, tumor immune evasion, immunotherapy), viral infections (HIV, SARS-CoV-2, hepatitis C), autoimmune diseases (Sjögren's syndrome, rheumatoid arthritis), and neurology. Primary applications include WB, IHC, IF, and IP, predominantly in human samples.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis | ||
Signal Transduct Target Ther Sintilimab plus concurrent chemoradiotherapy for treatment of locally advanced small cell lung cancer (SINCE-01): a phase II clinical trial. | ||
Nat Med Allogeneic NK cells with a bispecific innate cell engager in refractory relapsed lymphoma: a phase 1 trial | ||
Cell Dietary arginine drives codon-dependent MHC class I translation and improves immunity in colon tumorigenesis and respiratory viral infection. |
Reviews
What customers say
Customer feedback for this antibody is mixed. Two reviewers reported excellent performance in Western blotting, with one noting it "worked perfectly" on small cell lung cancer samples and another describing it as working "great" on Jy cells, both using a 1:1000 dilution. However, one reviewer was disappointed, reporting poor Western blot results after a 1-hour room-temperature incubation and unsuccessful immunoprecipitation attempts at both 4 and 10 ug/mL on ovarian cancer samples. Overall, the antibody performs well for Western blotting, though results may vary depending on protocol and sample type.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
SHIVA KRISHNA (Verified Customer) (08-06-2025) | I used this antibody for western blotting, and it worked perfectly.
|
Fabien (Verified Customer) (11-04-2022) | The antibody works great for western-blot.
|
Patricia (Verified Customer) (02-25-2020) | I tried probing my WB for 1 hour at RT, but it looked terrible, so I will try an overnight incubation. I've also tried my IP twice, once using 4 ug/mL, and the second time using 10 ug/mL. I had no pulldown either time. I'm quite disappointed.
|
