HLA class I ABC Polyclonal antibody

HLA class I ABC Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15240-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA, Cell treatment

HLA-A, HLA A, HLA class I, HLA class I (HLA-A), HLA class I histocompatibility antigen, A alpha chain

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, NCI-H1299 cells, Calu-1 cells, HEK-293 cells, HeLa cells, HepG2 cells, L02 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman tonsillitis tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, Raji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15240-1-AP targets HLA class I ABC in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA, Cell treatment applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7370

Product name: Recombinant human HLA class I (HLA-A) protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 28-303 aa of BC003069

Sequence: SMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQ

Predict reactive species
Full Name major histocompatibility complex, class I, A
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 44 kDa
GenBank Accession NumberBC003069
Gene Symbol HLA-A
Gene ID (NCBI) 3105
RRIDAB_1557426
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04439
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. (PMID: 667938; 3375250)

Protocols

Product Specific Protocols
WB protocol for HLA class I ABC antibody 15240-1-APDownload protocol
IHC protocol for HLA class I ABC antibody 15240-1-APDownload protocol
IF protocol for HLA class I ABC antibody 15240-1-APDownload protocol
IP protocol for HLA class I ABC antibody 15240-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

IRGQ-mediated autophagy in MHC class I quality control promotes tumor immune evasion

Authors - Lina Herhaus
humanWB

Nature

Inhibition of PCSK9 potentiates immune checkpoint therapy for cancer.

Authors - Xinjian Liu
humanWB

Signal Transduct Target Ther

Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis

Authors - Chuan Yang
humanWB

Cell

Targeting Pin1 renders pancreatic cancer eradicable by synergizing with immunochemotherapy.

Authors - Kazuhiro Koikawa
humanIHC

Cancer Discov

Spatial-Temporal Diversity of Extrachromosomal DNA Shapes Urothelial Carcinoma Evolution and the Tumor Immune Microenvironment

Authors - Wei Lv
human

Nat Cell Biol

An ARF6-Exportin-5 axis delivers pre-miRNA cargo to tumour microvesicles.

Authors - James W Clancy

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

SHIVA KRISHNA (Verified Customer) (08-06-2025)

I used this antibody for western blotting, and it worked perfectly.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Small cell lung cancer
FH

Fabien (Verified Customer) (11-04-2022)

The antibody works great for western-blot.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1,000
  • Cell Tissue Type: Jy cells
FH

Patricia (Verified Customer) (02-25-2020)

I tried probing my WB for 1 hour at RT, but it looked terrible, so I will try an overnight incubation. I've also tried my IP twice, once using 4 ug/mL, and the second time using 10 ug/mL. I had no pulldown either time. I'm quite disappointed.

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: 1:1000 for WB; 4-10 ug/mL IP
  • Cell Tissue Type: Ovarian cancer
Loading...