CoraLite® Plus 488-conjugated HLA class I ABC Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-15240

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using CoraLite® Plus 488 HLA class I ABC antibody (CL488-15240) at dilution of 1:200.

HLA class I ABC Polyclonal Antibody for IF/ICC

Cat No. CL488-15240

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

HLA A, HLAA, HLA-A, MHC class I antigen A*3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15240 targets HLA class I ABC in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7370

  Product name: Recombinant human HLA class I (HLA-A) protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-303 aa of BC003069

  Sequence: SMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQ

• Full Name: major histocompatibility complex, class I, A
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC003069
• Gene Symbol: HLA-A
• Gene ID (NCBI): 3105
• RRID: AB_2919115
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04439
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. (PMID: 667938; 3375250)