HLA-G Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HLA-G Polyclonal antibody (16913-1-AP)

HLA-G Polyclonal Antibody for WB, ELISA

Cat No. 16913-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

HLA 6.0, HLA G, HLA G antigen, HLAG, HLA-G, MHC class I antigen G, MHC G

• 

  WB analysis of human placenta using 16913-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 16913-1-AP (HLA-G Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16913-1-AP targets HLA-G in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10577

  Product name: Recombinant human HLA-G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-308 aa of BC021708

  Sequence: SHSMRYFSAAVSRPSRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEREGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETKPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI

• Full Name: major histocompatibility complex, class I, G
• Calculated Molecular Weight: 338 aa, 38 kDa
• Observed Molecular Weight: 33-45 kDa
• GenBank Accession Number: BC021708
• Gene Symbol: HLA-G
• Gene ID (NCBI): 3135
• RRID: AB_2878330
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17693
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). HLA-G is a non-classical MHC class I molecule with multiple immunoregulatory properties. HLA-G exhibits a restricted pattern of expression that includes placental extravillous trophoblasts at the maternal-fetal interface, where it abolishes maternal immune cell activity against fetus and establishes immune tolerance. Aberrant expression of HLA-G has been found in a variety of human neoplastic diseases. It plays an important role in the escape of tumor cells from immunosurveillance.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Aging Cell; Advanced maternal age causes premature placental senescence and malformation via dysregulated α-Klotho expression in trophoblasts.; Authors - Zhi Chen
human	IHC	Front Immunol; Decreased USP2a Expression Inhibits Trophoblast Invasion and Associates With Recurrent Miscarriage.; Authors - Jiayu Wang
human	WB	Cell Prolif; Epiregulin promotes trophoblast epithelial-mesenchymal transition through poFUT1 and O-fucosylation by poFUT1 on uPA.; Authors - Xinyuan Cui
human	IF	Placenta; Reduced level of BMI1 inhibits trophoblast proliferation and migration via the epigenetic enhancement of CSTA and TGFB2 in spontaneous abortion; Authors - Huimin Li
human	WB	World J Gastrointest Oncol; Colony-stimulating factor 3 and its receptor promote leukocyte immunoglobulin-like receptor B2 expression and ligands in gastric cancer; Authors - Long Wang