HO-1/Hmox1 Polyclonal antibody

• 

  WB analysis using 31253-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 31253-1-AP (HO-1/Hmox1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31253-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31253-1-AP (HO-1/Hmox1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

HO-1/Hmox1 Polyclonal Antibody for WB, ELISA

Cat No. 31253-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Hmox1, HO-1, D8Wsu38e, heme oxygenase (decycling) 1, Hemox

---

Tested Applications

• Positive WB detected in: J774A.1 cells, RAW 264.7 cells, RAW 264.7 cells mouse kidney tissue mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31253-1-AP targets HO-1/Hmox1 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0938

  Product name: Recombinant mouse HO-1/Hmox1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 1-266 aa of NM_010442.2

  Sequence: MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT

• Full Name: heme oxygenase (decycling) 1
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: NM_010442.2
• Gene Symbol: HO-1
• Gene ID (NCBI): 15368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14901
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Heme Oxygenase-1 (HO-1) is a stress-inducible enzyme that plays a crucial role in cellular and tissue homeostasis. It is the rate-limiting enzyme responsible for the oxidative degradation of heme, producing carbon monoxide (CO), free iron, and biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. These byproducts have significant biological activities, contributing to HO-1's anti-inflammatory, cytoprotective, and immunomodulatory effects. (PMID: 33923744)