HPRT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HPRT Polyclonal antibody (15059-1-AP)

• Featured Product
• KD/KO Validated

HPRT Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15059-1-AP Copied!

Publications (48)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

HPRT1, EC:2.4.2.8, HGPRT, HGPRTase, Hypoxanthine-guanine phosphoribosyltransferase

• 

  WB analysis using 15059-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15059-1-AP (HPRT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 15059-1-AP

  WB result of HPRT antibody (15059-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HPRT transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15059-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15059-1-AP (HPRT antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 15059-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15059-1-AP (HPRT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 15059-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15059-1-AP (HPRT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 15059-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15059-1-AP (HPRT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 15059-1-AP

  IP result of anti-HPRT (IP:15059-1-AP, 4ug; Detection:15059-1-AP 1:6000) with mouse brain tissue lysate 1280 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15059-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15059-1-AP (HPRT antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15059-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15059-1-AP (HPRT antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15059-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15059-1-AP (HPRT antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15059-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15059-1-AP (HPRT antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15059-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 15059-1-AP (HPRT Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15059-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 15059-1-AP (HPRT Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15059-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using HPRT antibody (15059-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 15059-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human HPRT (15059-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HPRT in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, MCF-7 cells, mouse liver tissue, Jurkat cells, mouse brain tissue, rat brain tissue, HepG2 cells, Y79 cells, NIH/3T3 cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue, human liver cancer tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 ul suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15059-1-AP targets HPRT in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7044

  Product name: Recombinant human HPRT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-218 aa of BC000578

  Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

• Full Name: hypoxanthine phosphoribosyltransferase 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC000578
• Gene Symbol: HPRT1
• Gene ID (NCBI): 3251
• RRID: AB_10638622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00492
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT1 is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout.

Publications

What published studies show

Able is busy answering your previous question. Please try again later.

Automatically generated from the 48 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nature; Metabolite glues as a means of purine sensing and chemotherapeutic response.; Authors - Samuel R. Witus
		Cell; Dietary arginine drives codon-dependent MHC class I translation and improves immunity in colon tumorigenesis and respiratory viral infection.; Authors - Qiushuang Wu
mouse,human	WB	Cell; A commonly inherited human PCSK9 germline variant drives breast cancer metastasis via LRP1 receptor; Authors - Wenbin Mei
		Cell Metab; Nuclear adenine activates hnRNPA2B1 to enhance antibacterial innate immunity; Authors - Shihao Zhang
mouse	WB	Nat Immunol; Purine salvage pathway protects CD8(+) T cells from metabolic stress.; Authors - Masaki Tajima
mouse,human	WB,IHC	Nat Commun; Hypoxanthine phosphoribosyl transferase 1 metabolizes temozolomide to activate AMPK for driving chemoresistance of glioblastomas; Authors - Jianxing Yin ; KD Validated

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review reports a 5-star rating for this antibody used in Western Blot. The reviewer found it worked properly on cerebellar lysates (20 µg of protein loaded) at a 1:5000 dilution, confirming reliable performance for this application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Andrea (Verified Customer) (07-24-2026)

It works properly by WB on cerebellar lysates (20ug of proteins loaded)

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: Cerebellum