CoraLite® Plus 488-conjugated HPRT Polyclonal antibody

• 

  IF Staining of HeLa using CL488-15059

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 HPRT antibody (CL488-15059) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

HPRT Polyclonal Antibody for IF/ICC

Cat No. CL488-15059

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

HPRT1, Hypoxanthine-guanine phosphoribosyltransferase, HGPRTase, HGPRT, EC:2.4.2.8

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15059 targets HPRT in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7044

  Product name: Recombinant human HPRT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-218 aa of BC000578

  Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

• Full Name: hypoxanthine phosphoribosyltransferase 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC000578
• Gene Symbol: HPRT1
• Gene ID (NCBI): 3251
• RRID: AB_3672617
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00492
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

HPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT1 is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout.