HSD3B2 Monoclonal antibody

• 

  WB analysis using 67572-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67572-1-Ig (HSD3B2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 67572-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67572-1-Ig (HSD3B2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 67572-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67572-1-Ig (HSD3B2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human adrenal gland using 67572-1-Ig

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67572-1-Ig (HSD3B2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig adrenal gland using 67572-1-Ig

  pig adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67572-1-Ig (HSD3B2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 67572-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using HSD3B2 antibody (67572-1-Ig, Clone: 2E7B4 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

HSD3B2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67572-1-Ig

Clone No.2E7B4

Publications(7)

Host / Isotype

Mouse / IgG1

Reactivity

human, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2E7B4, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, 3b HSD, 3-beta-HSD adrenal and gonadal type

---

Tested Applications

• Positive WB detected in: human placenta tissue, pig adrenal gland tissue, human adrenal gland tissue
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

67572-1-Ig targets HSD3B2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4291

  Product name: Recombinant human HSD3B2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-286 aa of BC038419

  Sequence: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP

• Full Name: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC038419
• Gene Symbol: HSD3B2
• Gene ID (NCBI): 3284
• RRID: AB_2882785
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P26439
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD3B2(3-beta-hydroxy-Delta(5)-steroid dehydrogenase) belongs to the 3-beta-HSD family and catalyzes the oxidation and isomerization of delta-5-3-beta-hydroxysteroid precursors into delta-4-ketosteroids, thus leading to the formation of all classes of steroid hormones.HSD3B2 is expressed almost exclusively in adrenals and gonads, whereas HSD3B1 is expressed predominantly in the placenta and skin(PMID:1682237). Defects in HSD3B2 are the cause of adrenal hyperplasia type 2 (AH2).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Part Fibre Toxicol; Chronic exposure to polystyrene microplastics induced male reproductive toxicity and decreased testosterone levels via the LH-mediated LHR/cAMP/PKA/StAR pathway.; Authors - Haibo Jin
human	WB	Ecotoxicol Environ Saf; Biochemical mechanisms of tributyltin chloride-induced cell toxicity in Sertoli cells; Authors - Pengchen Chen
human	WB	Birth Defects Res; Bisphenol A decreases progesterone synthesis in human ovarian granulosa cells.; Authors - Junfeng Qi
human	WB	Gynecol Endocrinol; N6-methyladenosine demethylase FTO related to hyperandrogenism in PCOS via AKT pathway; Authors - Yuan-Xue Jing
human	IHC	Pathol Res Pract; Disorganized adrenocortical zonational structure in COVID-19 patients: Implications of critical illness duration; Authors - Tian-Zi Wen
human	IHC,IF	Metabolism; Increased adrenal steroidogenesis and suppressed corticosteroid responsiveness in critical COVID-19; Authors - Tian-Zi Wen