HSP27 Polyclonal antibody

• 

  WB analysis using 18284-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18284-1-AP (HSP27 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18284-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18284-1-AP (HSP27 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 18284-1-AP

  WB result of HSP27 antibody (18284-1-AP; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HSP27 transfected HeLa cells.

• 

  WB analysis of mouse liver using 18284-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18284-1-AP (HSP27 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of C6 using 18284-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 18284-1-AP (HSP27 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 18284-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 18284-1-AP (HSP27 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 18284-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 18284-1-AP (HSP27 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 18284-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 18284-1-AP (HSP27 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 18284-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 18284-1-AP (HSP27 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 18284-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 18284-1-AP (HSP27 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 18284-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 18284-1-AP (HSP27 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 18284-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18284-1-AP (HSP27 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 18284-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18284-1-AP (HSP27 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 18284-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HSP27 antibody (18284-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of HeLa using 18284-1-AP

  Immunofluorescent analysis of Hela cells, using HSPB1 antibody 18284-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  IF Staining of MCF-7 using 18284-1-AP

  Immunofluorescent analysis of MCF-7 cells, using HSPB1 antibody 18284-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  FC experiment of MCF-7 using 18284-1-AP

  1X10^6 MCF-7 cells were intracellularly stained with 0.5 ug Anti-Human HSP27 (18284-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.5 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

HSP27 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 18284-1-AP

Publications(43)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

HSPB1, CMT2F, Estrogen-regulated 24 kDa protein, HMN2B, Hsp25

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, C6 cells, mouse liver tissue, HepG2 cells, U2OS cells
• Positive IHC detected in: human lung cancer tissue, human liver cancer tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 33 publications below
• IHC: See 6 publications below
• IF: See 5 publications below
• IP: See 1 publications below
• ELISA: See 1 publications below
• CoIP: See 1 publications below

Product Information

18284-1-AP targets HSP27 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken, fish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13161

  Product name: Recombinant human HSPB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of BC012768

  Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

• Full Name: heat shock 27kDa protein 1
• Calculated Molecular Weight: 19-23 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC012768
• Gene Symbol: HSPB1
• Gene ID (NCBI): 3315
• RRID: AB_2295540
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04792
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPB1, also known as heat shock protein 27 (HSP27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (PMID: 21353161). It's notable that mouse HSP27 is also named HSP25 and has the predicted MW between 19-23 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Oxidative cyclization reagents reveal tryptophan cation-π interactions; Authors - Xiao Xie
human	IF	Allergy; ACE2 downregulation in olfactory mucosa: Eosinophilic rhinosinusitis as COVID-19 protective factor?; Authors - Concepció Marin
		Autophagy; ATG4B/autophagin-1 regulates intestinal homeostasis and protects mice from experimental colitis.; Authors - Cabrera Sandra S
rat	IF	J Cell Biol; Human myocytes are protected from titin aggregation-induced stiffening by small heat shock proteins.; Authors - Sebastian Kötter
human	WB,CoIP	Cell Rep; Analysis of proteome-wide degradation dynamics in ALS SOD1 iPSC-derived patient neurons reveals disrupted VCP homeostasis; Authors - Konstantinos Tsioras
human	WB	Phytomedicine; Ginsenoside Rg5 inhibits glioblastoma by activating ferroptosis via NR3C1/HSPB1/NCOA4; Authors - Guoqing Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tom (Verified Customer) (09-28-2020)

HEK293T lysate (10ug) ran on 4-20% gradient gel. Blocking in 5% BSA for 1 hour, followed by HSP27 (1:1000 in block) overnight at 4 degrees. Goat anti-rabbit HRP (1:10,000) for 1 hour in block.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK293

HSP27 Antibody Western Blot validation (1:1000 dilution) in HEK293 (Cat no:18284-1-AP)