HUWE1 Polyclonal antibody

• 

  WB analysis using 19430-1-AP

  Daudi cells were subjected to SDS PAGE followed by western blot with 19430-1-AP (HUWE1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 19430-1-AP

  WB result of HUWE1 antibody (19430-1-AP, 1:1000) with 293 cells by Dr. Emilia Galperin, University of Kentucky.

• 

  IHC staining of human lung cancer using 19430-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 19430-1-AP (HUWE1 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 19430-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 19430-1-AP (HUWE1 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 19430-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19430-1-AP (HUWE1 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 19430-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19430-1-AP (HUWE1 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 19430-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 19430-1-AP (HUWE1 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 19430-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 19430-1-AP (HUWE1 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

HUWE1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19430-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

ARF binding protein 1, ARF BP1, ARF-binding protein 1, ARF-BP1, E3 ubiquitin-protein ligase HUWE1

---

Tested Applications

• Positive WB detected in: Daudi cells, HEK-293 cells
• Positive IHC detected in: human lung cancer tissue, human lung tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 12 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

19430-1-AP targets HUWE1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13763

  Product name: Recombinant human HUWE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 3983-4374 aa of BC002602

  Sequence: AVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVLRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA

• Full Name: HECT, UBA and WWE domain containing 1
• Calculated Molecular Weight: 437 aa, 482 kDa
• Observed Molecular Weight: 482 kDa-550 kDa
• GenBank Accession Number: BC002602
• Gene Symbol: HUWE1
• Gene ID (NCBI): 10075
• RRID: AB_2878579
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z6Z7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HUWE1 encodes a HECT domain ubiquitin ligase which is a large protein (500 kDa) has attracted considerable interest because several and quite disparate substrates have been assigned to this E3. It has a role in regulating Berg-mann glia differentiation and this ubiquitin ligase orchestrates the programming of the neural progenitors that give rise to neurons and glia in the cerebellum. HUWE1 is essential for proliferation of a subset of tumor cells, and negative regulator of TP53 during the colorectal carcinoma progression through the ubiquitination pathway mediated by the HECT domain (PMID:15567145). HUWE1 plays a critical role in lung cancer and increased HUWE1 expression is significantly associated with worse prognosis which suggest that HUWE1 might be a potential target for lung cancer therapy (PMID: 30026863).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Overcoming therapeutic resistance in oncolytic herpes virotherapy by targeting IGF2BP3-induced NETosis in malignant glioma; Authors - Weiwei Dai
human	WB	Mol Cell; WNK1 is an assembly factor for the human ER membrane protein complex.; Authors - Tino Pleiner
human	WB	Sci Adv; Genomic gain of RRS1 promotes hepatocellular carcinoma through reducing the RPL11-MDM2-p53 signaling.; Authors - Pengbo Cao ; KD Validated
mouse,human	WB	FASEB J; HUWE1 promotes EGFR ubiquitination and degradation to protect against renal tubulointerstitial fibrosis.; Authors - Qian Zhu
human	WB	J Cell Sci; Derlin-1 promotes ubiquitination and degradation of epithelial sodium channel (ENaC).; Authors - Hui You ; KD Validated
human	WB,IP	J Cell Sci; The role of USP7 in the Shoc2-ERK1/2 signaling axis and Noonan-like syndrome with loose anagen hair.; Authors - Patricia Wilson ; KD Validated