• Featured Product
  • KD/KO Validated

IBA1 Polyclonal antibody

IBA1 antibodies are primarily used as markers for microglia, the resident immune cells of the central nervous system, and for macrophages in peripheral tissues. Proteintech has an extensive validated IBA1 antibodies for IHC, IF-P, IF-Fro, ELISA and more.
Cat No. 10904-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

IHC, IF-P, FC (Intra), IP, ELISA

AIF1, AIF 1, AIF-1, allograft inflammatory factor 1, G1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IP detected inTHP-1 cells
Positive IHC detected inrat brain tissue, human brain tissue, human liver tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue, rat brain tissue
Positive FC (Intra) detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10904-1-AP targets IBA1 in IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, zebrafish, hamster, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1363

Product name: Recombinant human IBA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC009474

Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Predict reactive species
Full Name allograft inflammatory factor 1
Calculated Molecular Weight 17 kDa
GenBank Accession NumberBC009474
Gene Symbol IBA1
Gene ID (NCBI) 199
ENSEMBL Gene IDENSG00000204472
RRIDAB_2224377
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP55008
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

What is the molecular weight of IBA1?

The molecular weight of IBA1 is 16.7 kD.


 What is IBA1?

Ionized calcium-binding adaptor molecule 1 (IBA1), also known as Allograft inflammatory factor-1 (AIF-1), is an inflammation-responsive scaffold protein expressed and secreted from macrophages. Microglia response factor (MRF-1) and daintain are also similar, and likely identical, proteins (PMIDs: 29749461, 9630473, 23792284).


 What is the function of IBA1?

IBA1 is necessary for macrophage survival, and it is also a key molecule in proinflammatory activity (PMID: 29749461).


 Where is IBA1 localized?

IBA1 is a cytoplasmic protein, often expressed in immunocytes, macrophages, and microglia. It can be used as a marker for normal (not 'dark') microglia in brain tissue, as IBA1 is expressed by all microglial cell subpopulations (PMIDs: 29749461, 11943136, 26847266, 9630473).


 Is IBA1 upregulated in active immunophages?

Yes; its expression is associated with inflammatory activity (PMID: 29749461).


 How do IBA1-positive microglia differ from microglia that express less or no IBA1?

'Dark' microglia is a recently described phenotype associated with Alzheimer's disease pathology and chronic stress; these dark microglia express decreased IBA1 (often punctiform), and show distinct ultrastructural differences from 'normal' microglia as well as condensed and electron-dense cytoplasm and nucleoplasm. Normal microglia generally display strong, diffuse expression of IBA1. IBA1-positive microglial processes in normal conditions also have a strong tendency to exclusively contact synaptic elements, such as axon terminals, dendritic spines, and synaptic clefts (PMIDs: 29992181, 26847266).


 How is IBA1 related to Alzheimer's disease and pain?

Exacerbated immunoactivity of IBA1, particularly in proximity to amyloid plaques, is prominently featured in AD pathology. IBA1, along with other microglial markers, are also associated with pain, and robust microglial reactions often follow spinal cord injury (PMIDs: 29992181, 23792284).


Protocols

Product Specific Protocols
FC protocol for IBA1 antibody 10904-1-APDownload protocol
IF protocol for IBA1 antibody 10904-1-APDownload protocol
IHC protocol for IBA1 antibody 10904-1-APDownload protocol
IP protocol for IBA1 antibody 10904-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IHC

Acta Neuropathol

Splicing repression is a major function of TDP-43 in motor neurons.

Authors - Aneesh Donde
monkeyIF

Int J Surg

Stereotactically intracerebral transplantation of neural stem cells for ischemic stroke attenuated inflammatory responses and promoted neurogenesis: an experimental study with monkeys

Authors - Yi-Fan Liu
IF

Adv Sci (Weinh)

OTUD5 Protects Dopaminergic Neurons by Promoting the Degradation of α-Synuclein in Parkinson's Disease Model

Authors - Xiaomeng Song

ACS Nano

Nanozyme-Based Bandage with Single-Atom Catalysis for Brain Trauma.

Authors - Ruijuan Yan
mouseIF

Int J Surg

Bioinformatics analysis identifies CSF1R as an essential gene mediating Neuropathic pain - Experimental research.

Authors - Chao Xu
humanIF

Cell Death Differ

Redox regulation of TRIM28 facilitates neuronal ferroptosis by promoting SUMOylation and inhibiting OPTN-selective autophagic degradation of ACSL4

Authors - Wei Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Reyes (Verified Customer) (04-05-2024)

Iba1 (in green) marks clearly my microglia in human brain FFPE cortex.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
IBA1 Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:10904-1-AP)
FH

Alexandru (Verified Customer) (11-13-2023)

Very pleased with the antibody! I had a claer signal in all my stains.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:150
  • Cell Tissue Type: Mouse ventricle
FH

NX (Verified Customer) (02-27-2023)

A clean antibody to detect endogenous Iba1 from mouse brain lysate.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: mouse brain lysate
Loading...
||
New chat Able
正在加载,请稍候...