Recombinant human IGFBP3 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag20351
Synonyms
IGFBP3, BP 53, IBP 3, IBP3, IBP-3
Validation Data Gallery View All
Product Information
| Peptide Sequence |
PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
(134-291 aa encoded by BC000013) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
