• Featured Product
  • KD/KO Validated

IL-1 beta Monoclonal antibody

IL-1 beta Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66737-1-Ig
Clone No.2A1B4

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA, Cell treatment

2A1B4, Catabolin, IL 1, IL 1 beta, IL1 beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, A431 cells, U-87 MG cells
Positive IHC detected inhuman lung cancer tissue, human skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inLPS treated THP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66737-1-Ig targets IL-1 beta in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rabbit, bovine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26030

Product name: Recombinant human IL-1B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 117-269 aa of BC008678

Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Predict reactive species
Full Name interleukin 1, beta
Calculated Molecular Weight 269 aa, 31 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC008678
Gene Symbol IL1B
Gene ID (NCBI) 3553
ENSEMBL Gene IDENSG00000125538
RRIDAB_2882087
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01584
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.

Protocols

Product Specific Protocols
IF protocol for IL-1 beta antibody 66737-1-IgDownload protocol
IHC protocol for IL-1 beta antibody 66737-1-IgDownload protocol
WB protocol for IL-1 beta antibody 66737-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

Lighting up arginine metabolism reveals its functional diversity in physiology and pathology

Authors - Rui Li
IF

Adv Mater

Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment

Authors - Yuewen Zhai
humanIF

Biomaterials

Macromechanics and polycaprolactone fiber organization drive macrophage polarization and regulate inflammatory activation of tendon in vitro and in vivo.

Authors - Angelina D Schoenenberger
IHC

J Nanobiotechnology

Low-dose celecoxib-loaded PCL fibers reverse intervertebral disc degeneration by up-regulating CHSY3 expression

Authors - Yunhao Wang
WB,IF

J Nanobiotechnology

Implantation of biomimetic polydopamine nanocomposite scaffold promotes optic nerve regeneration through modulating inhibitory microenvironment

Authors - Tonghe Pan
WB,IHC

Cell Mol Life Sci

circACTA2 inhibits NLRP3 inflammasome-mediated inflammation via interacting with NF-κB in vascular smooth muscle cells

Authors - Yang Bai
Loading...
||
New chat

Able

正在加载,请稍候...