• Featured Product
  • KD/KO Validated

IL-17A Monoclonal antibody

IL-17A Monoclonal Antibody for WB, IF-P, ELISA

Cat No. 66148-1-Ig
Clone No.1B3D5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, ELISA

IL 17, IL17, IL-17, IL17A, 1B3D5

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, Jurkat cells, Raji cells, U-937 cells, MOLT-4 cells, Ramos cells, Daudi cells, HL-60 cells, RAW 264.7 cells
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66148-1-Ig targets IL-17A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3733

Product name: Recombinant human IL-17A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-155 aa of BC067505

Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Predict reactive species
Full Name interleukin 17A
Calculated Molecular Weight 155 aa, 18 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC067505
Gene Symbol IL-17A
Gene ID (NCBI) 3605
ENSEMBL Gene IDENSG00000112115
RRIDAB_2881544
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ16552
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.

Protocols

Product Specific Protocols
WB protocol for IL-17A antibody 66148-1-IgDownload protocol
IF protocol for IL-17A antibody 66148-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Clin Immunol

Potential therapeutic effect of dimethyl fumarate on Treg/Th17 cell imbalance in biliary atresia

Authors - Mengting Liu
mouseWB,IHC

Int J Pharm

Microneedle system carrying Momordin Ic-loaded ROS-responsive hydrogel ameliorates psoriasis via targeted anti-inflammatory and reactive oxygen species (ROS)-scavenging mechanisms

Authors - Chang Wang
mouseWB

Mol Nutr Food Res

A High MCT-Based Ketogenic Diet Suppresses Th1 and Th17 Responses to Ameliorate Experimental Autoimmune Encephalomyelitis in Mice by Inhibiting GSDMD and JAK2-STAT3/4 Pathways

Authors - Qianye Zhang
mouseIHC

J Integr Med

Ethanol extract of Herpetospermum caudigerum Wall ameliorates psoriasis-like skin inflammation and promotes degradation of keratinocyte-derived ICAM-1 and CXCL9

Authors - Ya Zhong
mouseWB

Int Immunopharmacol

(RS)-bambuterol and its enantiomers: Potential improvement of (R)-bambuterol in mice with colitis.

Authors - Liangjun Deng
humanWB

Int Immunopharmacol

IL-17A drives cognitive aging probably via inducing neuroinflammation and theta oscillation disruption in the hippocampus.

Authors - Yachun Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Rosa (Verified Customer) (07-08-2022)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:150
  • Cell Tissue Type: adipose tissue
IL-17A Antibody Immunofluorescence validation (1:150 dilution) in adipose tissue (Cat no:66148-1-Ig)
Loading...