IL-1 beta Polyclonal antibody

• 

  WB analysis using 16806-1-AP

  Non-treated THP-1 cells, THP-1 cells (treated with 100 ng/ml LPS for 3h, then added 300 ng/ml protein transport inhibitor for 3h) were subjected to SDS PAGE followed by western blot with 16806-1-AP (IL-1 Beta antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 16806-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 16806-1-AP (IL1 beta antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human adrenal gland using 16806-1-AP

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 16806-1-AP (IL1 beta antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 16806-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16806-1-AP (IL-1 Beta antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 16806-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16806-1-AP (IL-1 Beta antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 16806-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16806-1-AP (IL1 beta antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 16806-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16806-1-AP (IL1 beta antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 16806-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16806-1-AP (IL1 beta antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 16806-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16806-1-AP (IL1 beta antibody at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human tonsillitis using 16806-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16806-1-AP (IL1 beta antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 16806-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16806-1-AP (IL1 beta antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of THP-1 using 16806-1-AP

  Immunofluorescent analysis of (4% PFA) fixed LPS treated THP-1 cells using IL-1 beta antibody (16806-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

IL-1 beta Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16806-1-AP

Publications(889)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (7)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Catabolin, IL 1, IL 1 beta, IL1 beta, IL1- beta

---

Tested Applications

• Positive WB detected in: LPS and Protein transport inhibitor treated THP-1 cells, human adrenal gland tissue, A431 cells
• Positive IHC detected in: human tonsillitis tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: LPS treated THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 723 publications below
• IHC: See 146 publications below
• IF: See 79 publications below
• ELISA: See 5 publications below

Product Information

16806-1-AP targets IL-1 beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig, rabbit, canine, zebrafish, bovine, sheep, duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10295

  Product name: Recombinant human IL-1 beta protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-269 aa of BC008678

  Sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

• Full Name: interleukin 1, beta
• Calculated Molecular Weight: 269 aa, 31 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC008678
• Gene Symbol: IL1B
• Gene ID (NCBI): 3553
• ENSEMBL Gene ID: ENSG00000125538
• RRID: AB_10646432
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01584
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Immunity; Omega-3 fatty acids prevent inflammation and metabolic disorder through inhibition of NLRP3 inflammasome activation.; Authors - Yiqing Yan
zebrafish	IF	Cell; Migratory Neural Crest Cells Phagocytose Dead Cells in the Developing Nervous System.; Authors - Yunlu Zhu
	WB	Trends Biotechnol; Chairside live biotherapeutic hydrogel for comprehensive periodontitis therapy; Authors - Kaifeng Li
human	WB	Nat Commun; Cell enlargement modulated by GATA4 and YAP instructs the senescence-associated secretory phenotype; Authors - Joae Joung
	WB,IF	Small; M2 Macrophage Membrane-Mediated Biomimetic-Nanoparticle Carrying COX-siRNA Targeted Delivery for Prevention of Tendon Adhesions by Inhibiting Inflammation; Authors - Jie Sun
		Nat Commun; Downregulation of cytoplasmic DNases is implicated in cytoplasmic DNA accumulation and SASP in senescent cells.; Authors - Akiko Takahashi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Margarita (Verified Customer) (06-06-2023)

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: PC3 cells

IL-1 beta Antibody Immunofluorescence validation (1:200 dilution) in PC3 cells (Cat no:16806-1-AP)

FH

Margarita (Verified Customer) (06-22-2022)

Secondary antibody: Anti-Rabbit AF 594

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:50
• Cell Tissue Type: PC3 cells

IL-1 beta Antibody Immunofluorescence validation (1:50 dilution) in PC3 cells (Cat no:16806-1-AP)