IL-1RAP Polyclonal antibody

• 

  WB analysis using 30966-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30966-1-AP (IL-1RAP antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 30966-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 30966-1-AP (IL-1RAP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 30966-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30966-1-AP (IL-1RAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 30966-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30966-1-AP (IL-1RAP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 30966-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 30966-1-AP (IL-1RAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 30966-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 30966-1-AP (IL-1RAP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 30966-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30966-1-AP (IL-1RAP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 30966-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30966-1-AP (IL-1RAP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IL-1RAP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30966-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

IL1RAP, IL-1 receptor accessory protein, IL 1RAcP, IL 1R3, IL 1R 3

---

Tested Applications

• Positive WB detected in: HeLa cells, human placenta tissue, mouse liver tissue
• Positive IHC detected in: human placenta tissue, human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

30966-1-AP targets IL-1RAP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34121

  Product name: Recombinant human IL1RAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 389-570 aa of NM_001167928.1

  Sequence: YRAHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQGLSYSSLKNV

• Full Name: interleukin 1 receptor accessory protein
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001167928.1
• Gene Symbol: IL1RAP
• Gene ID (NCBI): 3556
• RRID: AB_3669798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NPH3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-1RAP (Interleukin-1 receptor accessory protein), also known as IL-1RAcP, IL-1R-3, or IL-1R3, is a member of the interleukin-1 receptor family. IL-1RAP is composed of an extracellular region containing three Ig-like C2 type domains, a transmembrane region, and a cytoplasmic region with a TIR (Toll-IL-1-receptor) domain. IL-1RAP functions as a co-receptor for IL-1, IL-33, IL-36. It plays an essential role in the signaling of the IL-1 family cytokines such as IL-1, IL-33, and IL-36, as well as tyrosine kinases FLT3 and c-Kit. IL-1RAP can also exist in a soluble form.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Oncol; Integrated single-cell and transcriptome sequencing data reveal the value of IL1RAP in gastric cancer microenvironment and prognosis; Authors - Weifeng Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alina (Verified Customer) (07-31-2025)

The Antibody had a strong signal, but it showed a second allegedly unspecific band. The Antibody was compared to another IL1RAP Antibody, that had a weaker signal but didn´t show an unspecific second band on the membrane. But all in all it is a good strong binding antibody.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500