IL-4 Polyclonal antibody

IL-4 antibodies are versatile tools for investigating IL-4’s roles in immunity, allergy, autoimmunity, and cancer, supporting a wide range of molecular, cellular, and functional assays. Proteintech has an extensive range of validated IL-4 antibodies antibodies for WB, IHC, IF-P, ELISA and more.
Cat No. 16545-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, ELISA

B cell stimulatory factor 1, Binetrakin, BSF 1, BSF1, IL 4, IL4, IL-4, interleukin 4, Pitrakinra

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

16545-1-AP targets IL-4 in WB, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9871

Product name: Recombinant human IL-4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-153 aa of BC070123

Sequence: GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Predict reactive species
Full Name interleukin 4
Calculated Molecular Weight 153 aa, 17 kDa
GenBank Accession NumberBC070123
Gene Symbol IL-4
Gene ID (NCBI) 3565
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05112
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

What is the molecular weight of IL-4?

IL-4 has a calculated weight of 14.9 kDa.

What cell type produces the IL-4 protein?

Mast cells in peripheral tissues produce the cytokines IL-4 and IL-13, both of which regulate response to environmental allergens. IL-4 in particular is synthesized rapidly following T cell activation to then stimulate downstream anti-inflammatory processes.

What activity does IL-4 stimulate?

IL-4 is a highly polyfunctional cytokine, contributing to the regulation of many cellular and immunological processes. Increases in IL-4 levels stimulate IL-13 production as well as helper T cell and B cell proliferative responses to anti-immunoglobulin antibodies. IL-4 also aids in controlling T helper cell type 2 (Th2) differentiation, driving differentiation of naive T cells to the Th2 pathway.

How do IL-4 levels respond to brain damage?

Ischemic neurons may secrete IL-4 to help decrease proinflammatory activity of macrophages.(PMID: 26269636)

How do IL-4 levels respond to allergens?

Asthmatics express stimulated IL-4 bronchoalveolar lavage during allergen challenges.

Can polymorphisms in the Il4 gene lead to asthma?

Polymorphisms resulting in mutant IL-4 proteins, are associated with asthma risk, development, and severity.

What does the IL-4: IFN-g ratio signify?

IL-4 promotes Th2 differentiation and stability, promoting its own production while inhibiting Th1 cell differentiation. The Th1 pathway, however, produces interferon gamma (IFN-g). The IL-4:IFN-g ratio gives indication as to which pathway is being enhanced or depressed.

PMIDs: 26088754, 26255210, 25819429,10556256


Publications

SpeciesApplicationTitle
ratELISA

Exp Neurol

Photobiomodulation therapy promotes neurogenesis by improving post-stroke local microenvironment and stimulating neuroprogenitor cells.

Authors - Luodan Yang
humanWB

J Transl Med

Immunotherapy landscape analyses of necroptosis characteristics for breast cancer patients.

Authors - Honghao Yu
humanWB

J Hematol Oncol

Ovatodiolide suppresses colon tumorigenesis and prevents polarization of M2 tumor-associated macrophages through YAP oncogenic pathways.

Authors - Yan-Jiun Huang
humanIF

Int J Mol Sci

The Human Cytomegalovirus β2.7 Long Non-Coding RNA Prevents Induction of Reactive Oxygen Species to Maintain Viral Gene Silencing during Latency

Authors - Marianne R Perera

Surgery

Sodium-glucose co-transporter 2 inhibitor canagliflozin modulates myocardial metabolism and inflammation in a swine model for chronic myocardial ischemia

Authors - Dwight D Harris
human

Int Immunopharmacol

Radical S-adenosyl methionine domain-containing 2, a potential target of D-tryptophan in asthma treatment, regulates T helper cell type 1/2 balance

Authors - Fei Wang
Loading...
||
New chat Able
正在加载,请稍候...